add gfp2
This commit is contained in:
mpabi
parent
68367f04c3
commit
4f3350fd7a
|
|
@ -0,0 +1,333 @@
|
|||
#! /usr/bin/env python3
|
||||
# vim:fenc=utf-8
|
||||
#
|
||||
# Copyright © 2024 user <user@penguin>
|
||||
#
|
||||
# Distributed under terms of the MIT license.
|
||||
import os
|
||||
from Bio import Entrez, SeqIO
|
||||
from Bio.Seq import Seq
|
||||
from Bio.SeqFeature import SeqFeature, FeatureLocation
|
||||
|
||||
from Bio.Restriction import RestrictionBatch, EcoRI, BamHI, HindIII, Bpu1102I
|
||||
from Bio.Restriction import AllEnzymes, Analysis
|
||||
|
||||
from Bio.Graphics import GenomeDiagram
|
||||
from reportlab.lib import colors
|
||||
|
||||
#%%
|
||||
# Ustawienia Entrez
|
||||
Entrez.email = "your_email@example.com" # Wpisz swój adres email
|
||||
|
||||
# Funkcja do pobierania sekwencji z NCBI i zapisywania jej lokalnie
|
||||
def fetch_and_save_sequence(db, id, file_path):
|
||||
handle = Entrez.efetch(db=db, id=id, rettype="gb", retmode="text")
|
||||
record = SeqIO.read(handle, "genbank")
|
||||
handle.close()
|
||||
SeqIO.write(record, file_path, "genbank")
|
||||
return record
|
||||
|
||||
# Funkcja do wczytywania sekwencji z lokalnego pliku
|
||||
def load_local_sequence(file_path):
|
||||
with open(file_path, 'r') as file:
|
||||
record = SeqIO.read(file, "genbank")
|
||||
return record
|
||||
|
||||
#%%
|
||||
|
||||
# ID dla sekwencji w NCBI
|
||||
gfp_id = "U87974"
|
||||
plasmid_id = "pET-28a(+)"
|
||||
|
||||
# Åcieżki do lokalnych plików
|
||||
gfp_file_path = gfp_id+'.gb'
|
||||
plasmid_file_path = plasmid_id+'.gb'
|
||||
|
||||
#%%
|
||||
# Sprawdzanie i pobieranie sekwencji GFP
|
||||
if not os.path.exists(gfp_file_path):
|
||||
print(f"Plik {gfp_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||
gfp_record = fetch_and_save_sequence("nuccore", gfp_id, gfp_file_path)
|
||||
print(f"Pobrano i zapisano sekwencjÄ GFP do pliku {gfp_file_path}.")
|
||||
else:
|
||||
print(f"Plik {gfp_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||
gfp_record = load_local_sequence(gfp_file_path)
|
||||
print(f"Wczytano dane z pliku {gfp_file_path}.")
|
||||
|
||||
gfp_seq = str(gfp_record.seq)
|
||||
print(f"GFP Sequence: {gfp_seq[:60]}...")
|
||||
|
||||
#%%
|
||||
# Sprawdzanie i pobieranie sekwencji plazmidu
|
||||
if not os.path.exists(plasmid_file_path):
|
||||
print(f"Plik {plasmid_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||
record = fetch_and_save_sequence("nuccore", plasmid_id, plasmid_file_path)
|
||||
print(f"Pobrano i zapisano sekwencjÄ plazmidu do pliku {plasmid_file_path}.")
|
||||
else:
|
||||
print(f"Plik {plasmid_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||
record = load_local_sequence(plasmid_file_path)
|
||||
print(f"Wczytano dane z pliku {plasmid_file_path}.")
|
||||
|
||||
#%%
|
||||
# WyÅwietl etykiety (annotacje)
|
||||
for feature in record.features:
|
||||
print(f"Type: {feature.type}")
|
||||
print(f"Location: {feature.location}")
|
||||
if 'gene' in feature.qualifiers:
|
||||
print(f"Gene: {feature.qualifiers['gene']}")
|
||||
if 'product' in feature.qualifiers:
|
||||
print(f"Product: {feature.qualifiers['product']}")
|
||||
print()
|
||||
#%%
|
||||
|
||||
|
||||
#%%
|
||||
|
||||
# Przejdź przez wszystkie funkcje w rekordzie i wypisz ich szczegóÅowe informacje
|
||||
for feature in record.features:
|
||||
if feature.type in ["promoter", "RBS","CDS", "protein_bind", "misc_feature", "rep_origin", "terminator"]:
|
||||
print(f"Type: {feature.type}")
|
||||
print(f"Location: {feature.location}")
|
||||
print(f"Strand: {'+' if feature.strand == 1 else '-'}")
|
||||
|
||||
# SzczegóÅowe opisy
|
||||
if feature.type == "CDS":
|
||||
gene_name = feature.qualifiers.get('gene', ['Unknown gene'])[0]
|
||||
product = feature.qualifiers.get('product', ['Unknown product'])[0]
|
||||
print(f"Gene Name: {gene_name}")
|
||||
print(f"Product: {product}")
|
||||
elif feature.type == "protein_bind":
|
||||
binding_site = feature.qualifiers.get('bound_moiety', ['Unknown binding site'])[0]
|
||||
print(f"Binding Site: {binding_site}")
|
||||
elif feature.type == "misc_feature":
|
||||
note = feature.qualifiers.get('note', ['No additional information'])[0]
|
||||
print(f"Note: {note}")
|
||||
elif feature.type == "rep_origin":
|
||||
print("This is a replication origin.")
|
||||
|
||||
# Pobierz sekwencjÄ funkcji
|
||||
feature_seq = record.seq[feature.location.start:feature.location.end]
|
||||
|
||||
|
||||
print(f"Sequence ( ): {feature_seq}\n")
|
||||
# UwzglÄdnij orientacjÄ nici (strand)
|
||||
if feature.strand == -1:
|
||||
feature_seq = feature_seq.reverse_complement()
|
||||
print(f"Sequence (^): {feature_seq}\n")
|
||||
|
||||
|
||||
|
||||
# Znajdź i wyÅwietl sekwencjÄ terminatora T7
|
||||
for feature in record.features:
|
||||
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||
print("Terminator T7 znaleziony:")
|
||||
print(f"Type: {feature.type}")
|
||||
print(f"Location: {feature.location}")
|
||||
print(f"Sequence: {record.seq[feature.location.start:feature.location.end]}")
|
||||
print()
|
||||
|
||||
|
||||
|
||||
|
||||
#%%
|
||||
# Znajdź i wyÅwietl sekwencjÄ terminatora T7
|
||||
for feature in record.features:
|
||||
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||
print("Terminator T7 znaleziony:")
|
||||
print(f"Type: {feature.type}")
|
||||
print(f"Location: {feature.location}")
|
||||
|
||||
# Pobierz sekwencjÄ terminatora
|
||||
terminator_seq = record.seq[feature.location.start:feature.location.end]
|
||||
|
||||
# Sprawdź orientacjÄ i odwróÄ/uzupeÅnij jeÅli potrzebne
|
||||
if feature.strand == -1:
|
||||
terminator_seq = terminator_seq.reverse_complement()
|
||||
|
||||
print(f"(+) Sequence: {terminator_seq}")
|
||||
print()
|
||||
|
||||
#%%
|
||||
|
||||
|
||||
#%%
|
||||
t=record[25:73].seq
|
||||
|
||||
|
||||
#%%
|
||||
a = str (t)
|
||||
a
|
||||
|
||||
#%%
|
||||
class Model:
|
||||
|
||||
complement = {'A': 'T', 'T': 'A', 'C': 'G', 'G': 'C'}
|
||||
|
||||
def __init__ (self, seq=None):
|
||||
self.seq = seq
|
||||
|
||||
def complement_dna(self):
|
||||
|
||||
complementary_sequence = ''.join(self.complement[base] for base in self.seq)
|
||||
return complementary_sequence
|
||||
|
||||
#%%
|
||||
r = Model(a)
|
||||
|
||||
#%%
|
||||
r.seq
|
||||
|
||||
#%%
|
||||
r.seq[::-1]
|
||||
|
||||
#%%
|
||||
r.complement_dna()
|
||||
|
||||
#%%
|
||||
r.seq
|
||||
#%%
|
||||
complement = {'A': 'T', 'T': 'A', 'C': 'G', 'G': 'C'}
|
||||
complementary_sequence = ''.join(complement[base] for base in r.seq)
|
||||
complementary_sequence
|
||||
|
||||
#%%
|
||||
|
||||
|
||||
#%%
|
||||
# Sekwencja DNA
|
||||
dna_seq = record.seq
|
||||
|
||||
# Znajdź miejsca ciÄcia dla NcoI i Bpu1102I
|
||||
ncoI_sites = NcoI.search(dna_seq)
|
||||
bpu1102I_sites = Bpu1102I.search(dna_seq)
|
||||
|
||||
# Przyjmij pierwsze miejsca ciÄcia
|
||||
ncoI_site = ncoI_sites[0]
|
||||
bpu1102I_site = bpu1102I_sites[0]
|
||||
|
||||
# WyodrÄbnij fragmenty 20 zasad od miejsc ciÄcia
|
||||
ncoI_fragment = dna_seq[ncoI_site-16:ncoI_site+4] # 16 zasad przed i 4 po ciÄciu
|
||||
bpu1102I_fragment = dna_seq[bpu1102I_site:bpu1102I_site+20] # 20 zasad po ciÄciu
|
||||
|
||||
# Lepkie koÅce
|
||||
ncoI_sticky_end = ncoI_fragment[-4:]
|
||||
ncoI_sticky_end_comp = ncoI_sticky_end.complement()
|
||||
|
||||
bpu1102I_sticky_end = bpu1102I_fragment[:4]
|
||||
bpu1102I_sticky_end_comp = bpu1102I_sticky_end.complement()
|
||||
|
||||
# Funkcja do wyÅwietlania dwuniciowego DNA z lepkimi koÅcami w formacie schodkowym z indeksami dla dÅuższej nici
|
||||
def print_sticky_ends(seq1, sticky_end1, seq2, sticky_end2, start1, start2):
|
||||
# Convert sequences to strings
|
||||
seq1_str = str(seq1)
|
||||
sticky_end1_str = str(sticky_end1)
|
||||
comp_seq1_str = str(seq1.complement())
|
||||
sticky_end1_comp_str = str(sticky_end1.complement())
|
||||
|
||||
seq2_str = str(seq2)
|
||||
sticky_end2_str = str(sticky_end2)
|
||||
comp_seq2_str = str(seq2.complement())
|
||||
sticky_end2_comp_str = str(sticky_end2.complement())
|
||||
|
||||
# Add indexes to the ends
|
||||
seq1_with_index = f"{seq1_str[:-1]} -{start1+len(seq1_str)-1}"
|
||||
comp_seq1_with_index = f"{comp_seq1_str[:-1]}"
|
||||
|
||||
seq2_with_index = f"{start2}- {seq2_str[1:]}"
|
||||
comp_seq2_with_index = f"{comp_seq2_str[1:]}"
|
||||
|
||||
# Lustrzane odbicie sekwencji
|
||||
comp_seq2_with_index = comp_seq2_with_index[::-1]
|
||||
sticky_end2_comp_str = sticky_end2_comp_str[::-1]
|
||||
|
||||
# Format the output as requested
|
||||
print(f"5'-{seq1_with_index} {sticky_end1_str}-3' (+)")
|
||||
print(f"3'-{comp_seq1_with_index}{sticky_end1_comp_str}-5'")
|
||||
print()
|
||||
print(f"5'-{sticky_end2_str} {seq2_with_index}-3' (+)")
|
||||
print(f" {sticky_end2_comp_str}{comp_seq2_with_index}-5'")
|
||||
|
||||
# WyÅwietl lepkie koÅce fragmentów
|
||||
print("Fragmenty po ciÄciu NcoI i Bpu1102I:")
|
||||
print_sticky_ends(ncoI_fragment[:-4], ncoI_sticky_end, bpu1102I_fragment[4:], bpu1102I_sticky_end, ncoI_site-16, bpu1102I_site)
|
||||
|
||||
#%%
|
||||
# Projektowanie starterów
|
||||
forward_primer = gfp_seq[:20] # Pierwsze 20 nukleotydów sekwencji GFP
|
||||
reverse_primer = str(Seq(gfp_seq_with_his6[-20:]).reverse_complement()) # Ostatnie 20 nukleotydów + His6
|
||||
|
||||
print(f"Forward Primer: {forward_primer}")
|
||||
print(f"Reverse Primer: {reverse_primer}")
|
||||
|
||||
#%%
|
||||
# Miejsca ciÄcia restryktazy
|
||||
enzymes = RestrictionBatch([EcoRI, BamHI, HindIII])
|
||||
#enzymes = RestrictionBatch([BamHI, ])
|
||||
restriction_sites = enzymes.search(record.seq)
|
||||
|
||||
#%%
|
||||
# Przeprowadzenie analizy restrykcyjnej
|
||||
analysis = Analysis(AllEnzymes, record.seq)
|
||||
|
||||
# Wynik analizy
|
||||
results = analysis.full()
|
||||
|
||||
# WyÅwietlanie wyników
|
||||
#for enzyme in results:
|
||||
# if len(results[enzyme]) > 0:
|
||||
# print(f"{enzyme}: {results[enzyme]}")
|
||||
|
||||
#%%
|
||||
# Utwórz diagram plazmidu
|
||||
diagram = GenomeDiagram.Diagram("PUC19 Plasmid Map")
|
||||
track = diagram.new_track(1, name="Annotated Features", greytrack=True)
|
||||
feature_set = track.new_set()
|
||||
|
||||
# Dodanie sekwencji kodujÄ
cej GFP
|
||||
feature_set.add_feature(
|
||||
SeqFeature(FeatureLocation(0, len(gfp_seq)), strand=+1),
|
||||
name="GFP Coding Sequence",
|
||||
label=True,
|
||||
color=colors.lightblue
|
||||
)
|
||||
|
||||
# Dodanie His6 tagu
|
||||
feature_set.add_feature(
|
||||
SeqFeature(FeatureLocation(len(gfp_seq), len(gfp_seq_with_his6)), strand=+1),
|
||||
name="His6 Tag",
|
||||
label=True,
|
||||
color=colors.lightgreen
|
||||
)
|
||||
|
||||
# Dodanie forward primer
|
||||
feature_set.add_feature(
|
||||
SeqFeature(FeatureLocation(0, len(forward_primer)), strand=+1),
|
||||
name="Forward Primer",
|
||||
label=True,
|
||||
color=colors.orange
|
||||
)
|
||||
|
||||
# Dodanie reverse primer
|
||||
feature_set.add_feature(
|
||||
SeqFeature(FeatureLocation(len(gfp_seq_with_his6) - len(reverse_primer), len(gfp_seq_with_his6)), strand=-1),
|
||||
name="Reverse Primer",
|
||||
label=True,
|
||||
color=colors.red
|
||||
)
|
||||
|
||||
# Dodanie miejsc ciÄcia restryktazy
|
||||
for enzyme, sites in restriction_sites.items():
|
||||
for site in sites:
|
||||
feature_set.add_feature(
|
||||
SeqFeature(FeatureLocation(site, site + 1), strand=0),
|
||||
name=enzyme,
|
||||
label=True,
|
||||
color=colors.purple
|
||||
)
|
||||
|
||||
# Rysowanie diagramu
|
||||
diagram.draw(format="circular", circular=True, pagesize='A4', start=0, end=len(record), circle_core=0.5)
|
||||
diagram.write("pdf/plasmid_map.pdf", "PDF")
|
||||
|
||||
print("Zapisano diagram plazmidu do pliku 'plasmid_map.pdf'")
|
||||
|
||||
|
|
@ -0,0 +1,194 @@
|
|||
LOCUS 40924_17796 5369 bp DNA circular SYN 14-OCT-2021
|
||||
DEFINITION synthetic circular DNA.
|
||||
ACCESSION .
|
||||
VERSION .
|
||||
KEYWORDS .
|
||||
SOURCE synthetic DNA construct
|
||||
ORGANISM synthetic DNA construct
|
||||
REFERENCE 1 (bases 1 to 5369)
|
||||
AUTHORS caoheibi
|
||||
TITLE Direct Submission
|
||||
REFERENCE 2 (bases 1 to 5369)
|
||||
AUTHORS .
|
||||
TITLE Direct Submission
|
||||
COMMENT SGRef: number: 1; type: "Journal Article"
|
||||
FEATURES Location/Qualifiers
|
||||
source 1..5369
|
||||
/mol_type="other DNA"
|
||||
/organism="synthetic DNA construct"
|
||||
terminator complement(26..73)
|
||||
/label=T7 terminator
|
||||
/note="transcription terminator for bacteriophage T7 RNA
|
||||
polymerase"
|
||||
CDS complement(140..157)
|
||||
/codon_start=1
|
||||
/label=6xHis
|
||||
/note="6xHis affinity tag"
|
||||
/translation="HHHHHH"
|
||||
CDS complement(207..239)
|
||||
/codon_start=1
|
||||
/label=T7 tag (gene 10 leader)
|
||||
/note="leader peptide from bacteriophage T7 gene 10"
|
||||
/translation="MASMTGGQQMG"
|
||||
CDS complement(243..260)
|
||||
/codon_start=1
|
||||
/label=thrombin site
|
||||
/note="thrombin recognition and cleavage site"
|
||||
/translation="LVPRGS"
|
||||
CDS complement(270..287)
|
||||
/codon_start=1
|
||||
/label=6xHis
|
||||
/note="6xHis affinity tag"
|
||||
/translation="HHHHHH"
|
||||
RBS complement(306..328)
|
||||
/label=RBS
|
||||
/note="efficient ribosome binding site from bacteriophage
|
||||
T7 gene 10 (Olins and Rangwala, 1989)"
|
||||
protein_bind complement(343..367)
|
||||
/label=lac operator
|
||||
/note="The lac repressor binds to the lac operator to
|
||||
inhibit transcription in E. coli. This inhibition can be
|
||||
relieved by adding lactose or
|
||||
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
|
||||
promoter complement(368..386)
|
||||
/label=T7 promoter
|
||||
/note="promoter for bacteriophage T7 RNA polymerase"
|
||||
promoter 695..772
|
||||
/label=lacI promoter
|
||||
CDS 773..1852
|
||||
/codon_start=1
|
||||
/label=lacI
|
||||
/note="lac repressor"
|
||||
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
|
||||
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
|
||||
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
|
||||
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
|
||||
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
|
||||
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
|
||||
ALADSLMQLARQVSRLESGQ"
|
||||
protein_bind 1868..1889
|
||||
/label=CAP binding site
|
||||
/note="CAP binding activates transcription in the presence
|
||||
of cAMP."
|
||||
CDS 2664..2852
|
||||
/codon_start=1
|
||||
/label=rop
|
||||
/note="Rop protein, which maintains plasmids at low copy
|
||||
number"
|
||||
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
|
||||
DELYRSCLARFGDDGENL"
|
||||
misc_feature 2957..3099
|
||||
/label=bom
|
||||
/note="basis of mobility region from pBR322"
|
||||
rep_origin complement(3285..3873)
|
||||
/direction=LEFT
|
||||
/label=ori
|
||||
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
|
||||
replication"
|
||||
CDS 3995..4807
|
||||
/codon_start=1
|
||||
/label=KanR
|
||||
/note="aminoglycoside phosphotransferase"
|
||||
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
|
||||
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
|
||||
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
|
||||
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
|
||||
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
|
||||
rep_origin complement(4903..5358)
|
||||
/direction=LEFT
|
||||
/label=f1 ori
|
||||
/note="f1 bacteriophage origin of replication; arrow
|
||||
indicates direction of (+) strand synthesis"
|
||||
ORIGIN
|
||||
1 atccggatat agttcctcct ttcagcaaaa aacccctcaa gacccgttta gaggccccaa
|
||||
61 ggggttatgc tagttattgc tcagcggtgg cagcagccaa ctcagcttcc tttcgggctt
|
||||
121 tgttagcagc cggatctcag tggtggtggt ggtggtgctc gagtgcggcc gcaagcttgt
|
||||
181 cgacggagct cgaattcgga tccgcgaccc atttgctgtc caccagtcat gctagccata
|
||||
241 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg
|
||||
301 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca
|
||||
361 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc
|
||||
421 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc
|
||||
481 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc
|
||||
541 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca
|
||||
601 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg
|
||||
661 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt
|
||||
721 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc
|
||||
781 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt
|
||||
841 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc
|
||||
901 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct
|
||||
961 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat
|
||||
1021 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg
|
||||
1081 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat
|
||||
1141 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt
|
||||
1201 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca
|
||||
1261 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc
|
||||
1321 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa
|
||||
1381 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat
|
||||
1441 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct
|
||||
1501 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg
|
||||
1561 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat
|
||||
1621 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg
|
||||
1681 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact
|
||||
1741 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc
|
||||
1801 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca
|
||||
1861 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga
|
||||
1921 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac
|
||||
1981 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca
|
||||
2041 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat
|
||||
2101 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg
|
||||
2161 gcgagaagca ggccattatc gccggcatgg cggccccacg ggtgcgcatg atcgtgctcc
|
||||
2221 tgtcgttgag gacccggcta ggctggcggg gttgccttac tggttagcag aatgaatcac
|
||||
2281 cgatacgcga gcgaacgtga agcgactgct gctgcaaaac gtctgcgacc tgagcaacaa
|
||||
2341 catgaatggt cttcggtttc cgtgtttcgt aaagtctgga aacgcggaag tcagcgccct
|
||||
2401 gcaccattat gttccggatc tgcatcgcag gatgctgctg gctaccctgt ggaacaccta
|
||||
2461 catctgtatt aacgaagcgc tggcattgac cctgagtgat ttttctctgg tcccgccgca
|
||||
2521 tccataccgc cagttgttta ccctcacaac gttccagtaa ccgggcatgt tcatcatcag
|
||||
2581 taacccgtat cgtgagcatc ctctctcgtt tcatcggtat cattaccccc atgaacagaa
|
||||
2641 atccccctta cacggaggca tcagtgacca aacaggaaaa aaccgccctt aacatggccc
|
||||
2701 gctttatcag aagccagaca ttaacgcttc tggagaaact caacgagctg gacgcggatg
|
||||
2761 aacaggcaga catctgtgaa tcgcttcacg accacgctga tgagctttac cgcagctgcc
|
||||
2821 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
|
||||
2881 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
|
||||
2941 ttggcgggtg tcggggcgca gccatgaccc agtcacgtag cgatagcgga gtgtatactg
|
||||
3001 gcttaactat gcggcatcag agcagattgt actgagagtg caccatatat gcggtgtgaa
|
||||
3061 ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc
|
||||
3121 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg
|
||||
3181 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc
|
||||
3241 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc
|
||||
3301 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga
|
||||
3361 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc
|
||||
3421 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat
|
||||
3481 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg
|
||||
3541 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc
|
||||
3601 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga
|
||||
3661 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact
|
||||
3721 agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt
|
||||
3781 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag
|
||||
3841 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg
|
||||
3901 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgaa caataaaact
|
||||
3961 gtctgcttac ataaacagta atacaagggg tgttatgagc catattcaac gggaaacgtc
|
||||
4021 ttgctctagg ccgcgattaa attccaacat ggatgctgat ttatatgggt ataaatgggc
|
||||
4081 tcgcgataat gtcgggcaat caggtgcgac aatctatcga ttgtatggga agcccgatgc
|
||||
4141 gccagagttg tttctgaaac atggcaaagg tagcgttgcc aatgatgtta cagatgagat
|
||||
4201 ggtcagacta aactggctga cggaatttat gcctcttccg accatcaagc attttatccg
|
||||
4261 tactcctgat gatgcatggt tactcaccac tgcgatcccc gggaaaacag cattccaggt
|
||||
4321 attagaagaa tatcctgatt caggtgaaaa tattgttgat gcgctggcag tgttcctgcg
|
||||
4381 ccggttgcat tcgattcctg tttgtaattg tccttttaac agcgatcgcg tatttcgtct
|
||||
4441 cgctcaggcg caatcacgaa tgaataacgg tttggttgat gcgagtgatt ttgatgacga
|
||||
4501 gcgtaatggc tggcctgttg aacaagtctg gaaagaaatg cataaacttt tgccattctc
|
||||
4561 accggattca gtcgtcactc atggtgattt ctcacttgat aaccttattt ttgacgaggg
|
||||
4621 gaaattaata ggttgtattg atgttggacg agtcggaatc gcagaccgat accaggatct
|
||||
4681 tgccatccta tggaactgcc tcggtgagtt ttctccttca ttacagaaac ggctttttca
|
||||
4741 aaaatatggt attgataatc ctgatatgaa taaattgcag tttcatttga tgctcgatga
|
||||
4801 gtttttctaa gaattaattc atgagcggat acatatttga atgtatttag aaaaataaac
|
||||
4861 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgaaattgta aacgttaata
|
||||
4921 ttttgttaaa attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg
|
||||
4981 aaatcggcaa aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc
|
||||
5041 cagtttggaa caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa
|
||||
5101 ccgtctatca gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt
|
||||
5161 cgaggtgccg taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac
|
||||
5221 ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta
|
||||
5281 gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg
|
||||
5341 cgccgctaca gggcgcgtcc cattcgcca
|
||||
//
|
||||
|
||||
Loading…
Reference in New Issue