From 40cc16cb4f7c44bada46da0b5dba064d66ac38cc Mon Sep 17 00:00:00 2001 From: mpabi Date: Thu, 20 Jun 2024 19:10:59 +0000 Subject: [PATCH] bio --- Dockerfile | 91 + __build | 1 + __docker-portainer | 4 + __incus-proxy | 1 + __n1 | 8 + __run | 1 + __run2 | 2 + __tracked_files | 34 + __uvicorn | 1 + _confs/.tmux.conf | 14 + _confs/.vimrc | 163 + app/database.py | 28 + app/main.py | 35 + app/models.py | 27 + app/schemas.py | 29 + data/pET-28a(+).gb | 194 + docker-compose.yaml | 36 + entrypoint.py | 47 + php/Dockerfile | 2 + pyproject.toml | 22 + static/index.html | 69 + static/script.js | 69 + static/style.css | 43 + static/vue.global.js | 16733 +++++++++++++++++++++++++++++++++++++++++ 24 files changed, 17654 insertions(+) create mode 100644 Dockerfile create mode 100644 __build create mode 100644 __docker-portainer create mode 100644 __incus-proxy create mode 100644 __n1 create mode 100644 __run create mode 100644 __run2 create mode 100644 __tracked_files create mode 100644 __uvicorn create mode 100644 _confs/.tmux.conf create mode 100644 _confs/.vimrc create mode 100644 app/database.py create mode 100644 app/main.py create mode 100644 app/models.py create mode 100644 app/schemas.py create mode 100644 data/pET-28a(+).gb create mode 100644 docker-compose.yaml create mode 100644 entrypoint.py create mode 100644 php/Dockerfile create mode 100644 pyproject.toml create mode 100644 static/index.html create mode 100644 static/script.js create mode 100644 static/style.css create mode 100644 static/vue.global.js diff --git a/Dockerfile b/Dockerfile new file mode 100644 index 0000000..f18ea68 --- /dev/null +++ b/Dockerfile @@ -0,0 +1,91 @@ +# Choose a base image. Debian is a good choice due to pyenv +FROM debian:latest + +# Update the package list and install necessary dependencies +RUN apt-get update && apt-get install -y \ + aptitude \ + tmux vim-nox nano mc git curl termshark procps \ + sudo iproute2 iputils-ping bridge-utils \ + ifupdown udev make build-essential libssl-dev zlib1g-dev \ + libbz2-dev libreadline-dev libsqlite3-dev wget llvm libncurses5-dev \ + libncursesw5-dev xz-utils libffi-dev liblzma-dev \ + sqlite3 default-libmysqlclient-dev pkg-config \ + npm + +# Set password for root user (optional, for configuration) +RUN echo 'root:rootpass' | chpasswd + +# Add a new user `user` with password `pass` and prepare the environment +RUN useradd -m user && echo 'user:pass' | chpasswd && adduser user sudo + +# Switch to user `user` +USER user +WORKDIR /home/user + +# Install pyenv +RUN git clone https://github.com/pyenv/pyenv .pyenv + +# Install pyenv-virtualenv +RUN git clone https://github.com/pyenv/pyenv-virtualenv .pyenv/plugins/pyenv-virtualenv + +# Set environment variables +ENV HOME /home/user +ENV PYENV_ROOT $HOME/.pyenv +ENV PATH $PYENV_ROOT/shims:$PYENV_ROOT/bin:$PATH + +# Add pyenv and pyenv-virtualenv configuration to .bashrc +RUN echo 'export PYENV_ROOT="$HOME/.pyenv"' >> .bashrc +RUN echo 'export PATH="$PYENV_ROOT/bin:$PATH"' >> .bashrc +RUN echo 'eval "$(pyenv init -)"' >> .bashrc +RUN echo 'eval "$(pyenv virtualenv-init -)"' >> .bashrc + +# Install Python 3.11 with --enable-shared +RUN bash -i -c "source ~/.bashrc && env PYTHON_CONFIGURE_OPTS='--enable-shared' pyenv install 3.11" + +# Create a virtual environment p3.11 +RUN bash -i -c "source ~/.bashrc && pyenv virtualenv 3.11 p3.11" + +# Set p3.11 as the default virtual environment +RUN bash -i -c "source ~/.bashrc && pyenv local p3.11" + +# Install Poetry +RUN curl -sSL https://install.python-poetry.org | python3 - + +# Add Poetry path to PATH directly in the Dockerfile +ENV PATH="$HOME/.local/bin:$PATH" + +# Install SQLAlchemy and MySQL adapter in the pyenv environment +RUN bash -i -c "source ~/.bashrc && pyenv activate p3.11 && pip install \ + sqlalchemy mysqlclient mysql-connector-python\ + ipython numpy scipy matplotlib \ + biopython" + +# Copy the project into the image +COPY --chown=user:user . /home/user/fapi +COPY ./_confs/* ./ + +# Set the working directory for installing dependencies +WORKDIR /home/user/fapi + +# Install project dependencies with Poetry in the p3.11 environment +RUN bash -i -c "source ~/.bashrc && pyenv activate p3.11 && poetry install" + +#RUN bash -i -c "source ~/.bashrc && poetry config virtualenvs.create false && poetry install" + +# Copy the .vimrc file +#COPY --chown=user:user .vimrc /home/user/.vimrc + +# Install vim-plug using curl +RUN curl -fLo ~/.vim/autoload/plug.vim --create-dirs \ + https://raw.githubusercontent.com/junegunn/vim-plug/master/plug.vim + +# Install Vim plugins +RUN vim +PlugInstall +qall + +# Run the application +#CMD ["/bin/bash", "-c", "python entrypoint.py"] + +# Run Bash +CMD ["/bin/bash"] + + diff --git a/__build b/__build new file mode 100644 index 0000000..3d3ad67 --- /dev/null +++ b/__build @@ -0,0 +1 @@ +docker build -t fapi . diff --git a/__docker-portainer b/__docker-portainer new file mode 100644 index 0000000..44b314f --- /dev/null +++ b/__docker-portainer @@ -0,0 +1,4 @@ +docker volume create portainer_data + +docker run -d -p 8000:8000 -p 9443:9443 --name portainer --restart=always -v /var/run/docker.sock:/var/run/docker.sock -v portainer_data:/data portainer/portainer-ce:latest + diff --git a/__incus-proxy b/__incus-proxy new file mode 100644 index 0000000..370660c --- /dev/null +++ b/__incus-proxy @@ -0,0 +1 @@ +sudo incus config device add tri proxy-9443 proxy listen=tcp:0.0.0.0:9443 connect=tcp:0.0.0.0:9443 diff --git a/__n1 b/__n1 new file mode 100644 index 0000000..b70a70c --- /dev/null +++ b/__n1 @@ -0,0 +1,8 @@ +docker run --rm \ + -dit \ + --privileged \ + -p 9999:9999 \ + -p 8888:8888 \ + -v /home/user/work/py/fapi/fapi:/home/user/fapi \ + --name f1 \ + fapi diff --git a/__run b/__run new file mode 100644 index 0000000..78ea769 --- /dev/null +++ b/__run @@ -0,0 +1 @@ +docker run --rm -dit -p $2:9999 --name $1 fapi diff --git a/__run2 b/__run2 new file mode 100644 index 0000000..7ab8c62 --- /dev/null +++ b/__run2 @@ -0,0 +1,2 @@ +#. ./__run2 mpabi 1111 +docker run --rm -dit -p $2:9999 --name $1 fapi bash diff --git a/__tracked_files b/__tracked_files new file mode 100644 index 0000000..6ccbfda --- /dev/null +++ b/__tracked_files @@ -0,0 +1,34 @@ +./Dockerfile + +./php/Dockerfile +./docker-compose.yaml + +./__build +./__n1 +./__run +./__run2 +./__uvicorn + +./__docker-portainer +./__incus-proxy + +./_confs/.tmux.conf +./_confs/.vimrc + +./app/schemas.py +./app/models.py +./app/main.py +./app/database.py + +./pyproject.toml + +./static/script.js +./static/style.css +./static/index.html +./static/vue.global.js + +./data/pET-28a(+).gb + +./entrypoint.py + +./__tracked_files diff --git a/__uvicorn b/__uvicorn new file mode 100644 index 0000000..ab99518 --- /dev/null +++ b/__uvicorn @@ -0,0 +1 @@ +poetry run uvicorn --reload app.main:app --host 0.0.0.0 --port 9999 diff --git a/_confs/.tmux.conf b/_confs/.tmux.conf new file mode 100644 index 0000000..2de7bd6 --- /dev/null +++ b/_confs/.tmux.conf @@ -0,0 +1,14 @@ +set-option -g default-command "bash --login" + +# remap prefix to Control + a +set -g prefix C-s +# bind 'C-a C-a' to type 'C-a' +bind C-s send-prefix +unbind C-b + +# synchronize all panes in a window +# don't use control S, too easily confused +# with navigation key sequences in tmux (show sessions) +unbind C-S +bind C-Y set-window-option synchronize-panes + diff --git a/_confs/.vimrc b/_confs/.vimrc new file mode 100644 index 0000000..1062b02 --- /dev/null +++ b/_confs/.vimrc @@ -0,0 +1,163 @@ +call plug#begin() + +Plug 'tpope/vim-fugitive' +Plug 'tpope/vim-commentary' +Plug 'preservim/nerdtree', { 'on': 'NERDTreeToggle' } + +Plug 'jupyter-vim/jupyter-vim' +Plug 'goerz/jupytext.vim' + +Plug 'ConradIrwin/vim-bracketed-paste' + +Plug 'rafi/awesome-vim-colorschemes' +Plug 'flazz/vim-colorschemes' + +Plug 'neoclide/coc.nvim', {'branch': 'release'} + +Plug 'jpalardy/vim-slime' + +call plug#end() + +nnoremap n :NERDTreeFocus +nnoremap :NERDTree +nnoremap :NERDTreeToggle +nnoremap :NERDTreeFind + + +" Run current file +nnoremap R :JupyterRunFile +nnoremap I :PythonImportThisFile + +" Change to directory of current file +nnoremap d :JupyterCd %:p:h + +" Send a selection of lines +nnoremap X :JupyterSendCell +nnoremap E :JupyterSendRange +nmap e JupyterRunTextObj +vmap e JupyterRunVisual + +" Debugging maps +nnoremap b :PythonSetBreak + +set backspace=indent,eol,start +set mouse=r + +packadd termdebug +let g:termdebug_wide=1 +let g:termdebugger='riscv32-esp-elf-gdb' + + +" Disable compatibility with vi which can cause unexpected issues. +set nocompatible + +" Enable type file detection. Vim will be able to try to detect the type of file in use. +filetype on + +" Enable plugins and load plugin for the detected file type. +filetype plugin on + +" Load an indent file for the detected file type. +filetype indent on + +" Turn syntax highlighting on. +syntax on + +" Add numbers to each line on the left-hand side. +set number + +" Highlight cursor line underneath the cursor horizontally. +set cursorline + +" Highlight cursor line underneath the cursor vertically. +" set cursorcolumn + +" Set shift width to 4 spaces. +set shiftwidth=4 + +" Set tab width to 4 columns. +set tabstop=4 + +" Use space characters instead of tabs. +set expandtab + +" Do not save backup files. +set nobackup + +" Do not let cursor scroll below or above N number of lines when scrolling. +set scrolloff=10 + +" Do not wrap lines. Allow long lines to extend as far as the line goes. +set nowrap + +" While searching though a file incrementally highlight matching characters as you type. +set incsearch + +" Ignore capital letters during search. +set ignorecase + +" Override the ignorecase option if searching for capital letters. +" This will allow you to search specifically for capital letters. +set smartcase + +" Show partial command you type in the last line of the screen. +set showcmd + +" Show the mode you are on the last line. +set showmode + +" Show matching words during a search. +set showmatch + +" Use highlighting when doing a search. +set hlsearch + +" Set the commands to save in history default number is 20. +set history=1000 + +" Enable auto completion menu after pressing TAB. +set wildmenu + +" Make wildmenu behave like similar to Bash completion. +set wildmode=list:longest + +" There are certain files that we would never want to edit with Vim. +" Wildmenu will ignore files with these extensions. +set wildignore=*.docx,*.jpg,*.png,*.gif,*.pdf,*.pyc,*.exe,*.flv,*.img,*.xlsx + + +" set colorscheme OceanicNext + + +if !exists("g:slime_python_ipython") + let g:slime_python_ipython = 1 +endif + +let g:slime_target = "tmux" + +" Run cell for vim-slime +function! SendCell(pattern) + let start_line = search(a:pattern, 'bnW') + + if start_line + let start_line = start_line + 1 + else + let start_line = 1 + endif + + let stop_line = search(a:pattern, 'nW') + if stop_line + let stop_line = stop_line - 1 + else + let stop_line = line('$') + endif + + call slime#send_range(start_line, stop_line) +endfunction + +" Custom vim-slime mappings +let g:slime_no_mappings = 1 +xmap SlimeRegionSend +nmap :call SendCell('^#%%') +nmap v SlimeConfig + diff --git a/app/database.py b/app/database.py new file mode 100644 index 0000000..a0e7f4f --- /dev/null +++ b/app/database.py @@ -0,0 +1,28 @@ +#%% +from sqlalchemy import create_engine +from sqlalchemy.ext.declarative import declarative_base +from sqlalchemy.orm import sessionmaker + +""" +#SQLALCHEMY_DATABASE_URL = "sqlite:///./test.db" # SQLite +engine = create_engine( + SQLALCHEMY_DATABASE_URL, connect_args={"check_same_thread": False} # Opcja dla SQLite +) +""" + +SQLALCHEMY_DATABASE_URL = "mysql+mysqlconnector://root:secret@172.18.0.2:3306/test" # Przykład dla MySQL +engine = create_engine( + SQLALCHEMY_DATABASE_URL, +) + +SessionLocal = sessionmaker(autocommit=False, autoflush=False, bind=engine) + +Base = declarative_base() + + +#%% +from sqlalchemy import text + +with engine.connect() as conn: + result = conn.execute(text("select 'hello world'")) + print(result.all()) diff --git a/app/main.py b/app/main.py new file mode 100644 index 0000000..f113e66 --- /dev/null +++ b/app/main.py @@ -0,0 +1,35 @@ +from fastapi import FastAPI, Depends +from fastapi.staticfiles import StaticFiles +from sqlalchemy.orm import Session +from .database import SessionLocal, engine +from .models import Sequence, Feature +from .database import Base + +app = FastAPI() + +Base.metadata.create_all(bind=engine) + +def get_db(): + db = SessionLocal() + try: + yield db + finally: + db.close() + +# Serwowanie plików statycznych +app.mount("/static", StaticFiles(directory="static"), name="static") + +@app.get("/sequences/") +def read_sequences(skip: int = 0, limit: int = 10, db: Session = Depends(get_db)): + sequences = db.query(Sequence).offset(skip).limit(limit).all() + return sequences + +@app.get("/features/") +def read_features(skip: int = 0, limit: int = 10, db: Session = Depends(get_db)): + features = db.query(Feature).offset(skip).limit(limit).all() + return features + +if __name__ == "__main__": + import uvicorn + uvicorn.run(app, host="0.0.0.0", port=9999) + diff --git a/app/models.py b/app/models.py new file mode 100644 index 0000000..fe7d738 --- /dev/null +++ b/app/models.py @@ -0,0 +1,27 @@ +# app/models.py +from sqlalchemy import Column, Integer, String, Text, ForeignKey +from sqlalchemy.orm import relationship +from .database import Base + +class Sequence(Base): + __tablename__ = "sequences" + + id = Column(Integer, primary_key=True, index=True) + name = Column(String, index=True) + description = Column(String) + sequence = Column(Text) + + features = relationship("Feature", back_populates="sequence") + +class Feature(Base): + __tablename__ = "features" + + id = Column(Integer, primary_key=True, index=True) + type = Column(String, index=True) + location = Column(String) + sequence = Column(Text) + qualifiers = Column(Text) + + sequence_id = Column(Integer, ForeignKey('sequences.id')) + sequence = relationship("Sequence", back_populates="features") + diff --git a/app/schemas.py b/app/schemas.py new file mode 100644 index 0000000..fc6fcdf --- /dev/null +++ b/app/schemas.py @@ -0,0 +1,29 @@ +from typing import List, Optional +from pydantic import BaseModel, constr, conint + +class AuthorCreate(BaseModel): + name: constr(min_length=2, max_length=100) + +class AuthorModel(BaseModel): + id: int + name: str + + class Config: + orm_mode = True + +class BookCreate(BaseModel): + title: constr(min_length=1, max_length=100) + author_id: conint(gt=0) + +class BookModel(BaseModel): + id: int + title: str + author_id: int + status: Optional[str] = None + + class Config: + orm_mode = True + +class BookWithAuthor(BookModel): + author: AuthorModel + diff --git a/data/pET-28a(+).gb b/data/pET-28a(+).gb new file mode 100644 index 0000000..077549a --- /dev/null +++ b/data/pET-28a(+).gb @@ -0,0 +1,194 @@ +LOCUS 40924_17796 5369 bp DNA circular SYN 14-OCT-2021 +DEFINITION synthetic circular DNA. +ACCESSION . +VERSION . +KEYWORDS . +SOURCE synthetic DNA construct + ORGANISM synthetic DNA construct +REFERENCE 1 (bases 1 to 5369) + AUTHORS caoheibi + TITLE Direct Submission +REFERENCE 2 (bases 1 to 5369) + AUTHORS . + TITLE Direct Submission +COMMENT SGRef: number: 1; type: "Journal Article" +FEATURES Location/Qualifiers + source 1..5369 + /mol_type="other DNA" + /organism="synthetic DNA construct" + terminator complement(26..73) + /label=T7 terminator + /note="transcription terminator for bacteriophage T7 RNA + polymerase" + CDS complement(140..157) + /codon_start=1 + /label=6xHis + /note="6xHis affinity tag" + /translation="HHHHHH" + CDS complement(207..239) + /codon_start=1 + /label=T7 tag (gene 10 leader) + /note="leader peptide from bacteriophage T7 gene 10" + /translation="MASMTGGQQMG" + CDS complement(243..260) + /codon_start=1 + /label=thrombin site + /note="thrombin recognition and cleavage site" + /translation="LVPRGS" + CDS complement(270..287) + /codon_start=1 + /label=6xHis + /note="6xHis affinity tag" + /translation="HHHHHH" + RBS complement(306..328) + /label=RBS + /note="efficient ribosome binding site from bacteriophage + T7 gene 10 (Olins and Rangwala, 1989)" + protein_bind complement(343..367) + /label=lac operator + /note="The lac repressor binds to the lac operator to + inhibit transcription in E. coli. This inhibition can be + relieved by adding lactose or + isopropyl-beta-D-thiogalactopyranoside (IPTG)." + promoter complement(368..386) + /label=T7 promoter + /note="promoter for bacteriophage T7 RNA polymerase" + promoter 695..772 + /label=lacI promoter + CDS 773..1852 + /codon_start=1 + /label=lacI + /note="lac repressor" + /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL + NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV + EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH + EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA + MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC + YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR + ALADSLMQLARQVSRLESGQ" + protein_bind 1868..1889 + /label=CAP binding site + /note="CAP binding activates transcription in the presence + of cAMP." + CDS 2664..2852 + /codon_start=1 + /label=rop + /note="Rop protein, which maintains plasmids at low copy + number" + /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA + DELYRSCLARFGDDGENL" + misc_feature 2957..3099 + /label=bom + /note="basis of mobility region from pBR322" + rep_origin complement(3285..3873) + /direction=LEFT + /label=ori + /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of + replication" + CDS 3995..4807 + /codon_start=1 + /label=KanR + /note="aminoglycoside phosphotransferase" + /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG + KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK + TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA + SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI + ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" + rep_origin complement(4903..5358) + /direction=LEFT + /label=f1 ori + /note="f1 bacteriophage origin of replication; arrow + indicates direction of (+) strand synthesis" +ORIGIN + 1 atccggatat agttcctcct ttcagcaaaa aacccctcaa gacccgttta gaggccccaa + 61 ggggttatgc tagttattgc tcagcggtgg cagcagccaa ctcagcttcc tttcgggctt + 121 tgttagcagc cggatctcag tggtggtggt ggtggtgctc gagtgcggcc gcaagcttgt + 181 cgacggagct cgaattcgga tccgcgaccc atttgctgtc caccagtcat gctagccata + 241 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg + 301 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca + 361 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc + 421 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc + 481 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc + 541 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca + 601 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg + 661 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt + 721 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc + 781 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt + 841 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc + 901 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct + 961 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat + 1021 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg + 1081 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat + 1141 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt + 1201 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca + 1261 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc + 1321 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa + 1381 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat + 1441 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct + 1501 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg + 1561 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat + 1621 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg + 1681 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact + 1741 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc + 1801 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca + 1861 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga + 1921 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac + 1981 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca + 2041 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat + 2101 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg + 2161 gcgagaagca ggccattatc gccggcatgg cggccccacg ggtgcgcatg atcgtgctcc + 2221 tgtcgttgag gacccggcta ggctggcggg gttgccttac tggttagcag aatgaatcac + 2281 cgatacgcga gcgaacgtga agcgactgct gctgcaaaac gtctgcgacc tgagcaacaa + 2341 catgaatggt cttcggtttc cgtgtttcgt aaagtctgga aacgcggaag tcagcgccct + 2401 gcaccattat gttccggatc tgcatcgcag gatgctgctg gctaccctgt ggaacaccta + 2461 catctgtatt aacgaagcgc tggcattgac cctgagtgat ttttctctgg tcccgccgca + 2521 tccataccgc cagttgttta ccctcacaac gttccagtaa ccgggcatgt tcatcatcag + 2581 taacccgtat cgtgagcatc ctctctcgtt tcatcggtat cattaccccc atgaacagaa + 2641 atccccctta cacggaggca tcagtgacca aacaggaaaa aaccgccctt aacatggccc + 2701 gctttatcag aagccagaca ttaacgcttc tggagaaact caacgagctg gacgcggatg + 2761 aacaggcaga catctgtgaa tcgcttcacg accacgctga tgagctttac cgcagctgcc + 2821 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca + 2881 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg + 2941 ttggcgggtg tcggggcgca gccatgaccc agtcacgtag cgatagcgga gtgtatactg + 3001 gcttaactat gcggcatcag agcagattgt actgagagtg caccatatat gcggtgtgaa + 3061 ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc + 3121 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg + 3181 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc + 3241 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc + 3301 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga + 3361 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc + 3421 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat + 3481 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg + 3541 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc + 3601 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga + 3661 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact + 3721 agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt + 3781 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag + 3841 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg + 3901 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgaa caataaaact + 3961 gtctgcttac ataaacagta atacaagggg tgttatgagc catattcaac gggaaacgtc + 4021 ttgctctagg ccgcgattaa attccaacat ggatgctgat ttatatgggt ataaatgggc + 4081 tcgcgataat gtcgggcaat caggtgcgac aatctatcga ttgtatggga agcccgatgc + 4141 gccagagttg tttctgaaac atggcaaagg tagcgttgcc aatgatgtta cagatgagat + 4201 ggtcagacta aactggctga cggaatttat gcctcttccg accatcaagc attttatccg + 4261 tactcctgat gatgcatggt tactcaccac tgcgatcccc gggaaaacag cattccaggt + 4321 attagaagaa tatcctgatt caggtgaaaa tattgttgat gcgctggcag tgttcctgcg + 4381 ccggttgcat tcgattcctg tttgtaattg tccttttaac agcgatcgcg tatttcgtct + 4441 cgctcaggcg caatcacgaa tgaataacgg tttggttgat gcgagtgatt ttgatgacga + 4501 gcgtaatggc tggcctgttg aacaagtctg gaaagaaatg cataaacttt tgccattctc + 4561 accggattca gtcgtcactc atggtgattt ctcacttgat aaccttattt ttgacgaggg + 4621 gaaattaata ggttgtattg atgttggacg agtcggaatc gcagaccgat accaggatct + 4681 tgccatccta tggaactgcc tcggtgagtt ttctccttca ttacagaaac ggctttttca + 4741 aaaatatggt attgataatc ctgatatgaa taaattgcag tttcatttga tgctcgatga + 4801 gtttttctaa gaattaattc atgagcggat acatatttga atgtatttag aaaaataaac + 4861 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgaaattgta aacgttaata + 4921 ttttgttaaa attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg + 4981 aaatcggcaa aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc + 5041 cagtttggaa caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa + 5101 ccgtctatca gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt + 5161 cgaggtgccg taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac + 5221 ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta + 5281 gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg + 5341 cgccgctaca gggcgcgtcc cattcgcca +// + diff --git a/docker-compose.yaml b/docker-compose.yaml new file mode 100644 index 0000000..c7b3d92 --- /dev/null +++ b/docker-compose.yaml @@ -0,0 +1,36 @@ +version: "3.7" +services: + + web-server: + build: + dockerfile: php/Dockerfile + context: . + restart: always + volumes: + - "./html/:/var/www/html/" + ports: + - "8080:80" + + mysql-server: + image: mysql:8.0.19 + restart: always + environment: + MYSQL_ROOT_PASSWORD: secret + volumes: + - mysql-data:/var/lib/mysql + ports: + - "3306:3306" + + phpmyadmin: + image: phpmyadmin/phpmyadmin:5.0.1 + restart: always + environment: + PMA_HOST: mysql-server + PMA_USER: root + PMA_PASSWORD: secret + ports: + - "5000:80" + +volumes: + mysql-data: + diff --git a/entrypoint.py b/entrypoint.py new file mode 100644 index 0000000..262e34d --- /dev/null +++ b/entrypoint.py @@ -0,0 +1,47 @@ +# entrypoint.py +from Bio import SeqIO +from sqlalchemy.orm import Session +from app.database import engine, SessionLocal, Base +from app.models import Sequence, Feature +import json + +# Tworzenie tabeli w bazie danych +Base.metadata.create_all(bind=engine) + +def get_db(): + db = SessionLocal() + try: + yield db + finally: + db.close() + +def load_genbank_to_db(file_path: str): + db = next(get_db()) + with open(file_path, 'r') as file: + record = SeqIO.read(file, "genbank") + + # Zapisz sekwencję do bazy danych + sequence_data = Sequence( + name=record.name, + description=record.description, + sequence=str(record.seq) + ) + db.add(sequence_data) + db.commit() + + # Zapisz cechy (features) do bazy danych + for feature in record.features: + feature_data = Feature( + type=feature.type, + location=str(feature.location), + sequence=str(record.seq[feature.location.start:feature.location.end]), + qualifiers=json.dumps(feature.qualifiers), + sequence_id=sequence_data.id + ) + db.add(feature_data) + db.commit() + print(f"Loaded {file_path} to database.") + +if __name__ == "__main__": + load_genbank_to_db("data/pET-28+(a).gb") + diff --git a/php/Dockerfile b/php/Dockerfile new file mode 100644 index 0000000..93494af --- /dev/null +++ b/php/Dockerfile @@ -0,0 +1,2 @@ +FROM php:7.4.3-apache +RUN docker-php-ext-install mysqli pdo pdo_mysql diff --git a/pyproject.toml b/pyproject.toml new file mode 100644 index 0000000..481020c --- /dev/null +++ b/pyproject.toml @@ -0,0 +1,22 @@ +[tool.poetry] +name = "app" +version = "0.1.0" +description = "Przykład aplikacji FastAPI z WebSockets i Flutter" +authors = ["mpabi"] + +[tool.poetry.dependencies] +python = "^3.8" +fastapi = "^0.85" +websockets = "^12.0" +sqlalchemy = "^2.0.26" +strawberry-graphql = {extras = ["fastapi"], version = "^0.219.2"} +mysqlclient = "^2.2.4" +mysql-connector-python = "^8.3.0" + +[tool.poetry.dev-dependencies] +uvicorn = "^0.17.6" + +[build-system] +requires = ["poetry-core>=1.0.0"] +build-backend = "poetry run pip install --no-deps ." +build-frontend = "poetry run flutter build web" diff --git a/static/index.html b/static/index.html new file mode 100644 index 0000000..30d9c63 --- /dev/null +++ b/static/index.html @@ -0,0 +1,69 @@ + + + + + + Feature Viewer + + + +
+

Feature Viewer

+ + +
+

Sequences:

+
    +
  • +

    Name: {{ sequence.name }}

    +

    Description: {{ sequence.description }}

    +

    Sequence: {{ sequence.sequence }}

    +
    • +
+
+
+

Features:

+
    +
  • +

    Type: {{ feature.type }}

    +

    Location: {{ feature.location }}

    +

    Sequence: {{ feature.sequence }}

    +

    Qualifiers: {{ feature.qualifiers }}

    +
    • +
+
+
+ + + + + diff --git a/static/script.js b/static/script.js new file mode 100644 index 0000000..4540378 --- /dev/null +++ b/static/script.js @@ -0,0 +1,69 @@ +const BASE_URL = 'http://qstack.pl:1111'; // Zaktualizuj zgodnie z konfiguracją Twojego serwera + +document.addEventListener('DOMContentLoaded', function() { + loadAuthors(); + loadBooks(); +}); + +document.getElementById('addAuthorForm').addEventListener('submit', function(e) { + e.preventDefault(); + const authorName = document.getElementById('authorName').value; + fetch(`${BASE_URL}/authors/`, { + method: 'POST', + headers: { 'Content-Type': 'application/json' }, + body: JSON.stringify({ name: authorName }), + }) + .then(response => response.json()) + .then(() => { + loadAuthors(); // Ponowne ładowanie listy autorów po dodaniu nowego autora + }) + .catch(error => console.error('Error:', error)); +}); + +document.getElementById('addBookForm').addEventListener('submit', function(e) { + e.preventDefault(); + const bookTitle = document.getElementById('bookTitle').value; + const bookAuthorId = document.getElementById('bookAuthorId').value; + fetch(`${BASE_URL}/books/`, { + method: 'POST', + headers: { 'Content-Type': 'application/json' }, + body: JSON.stringify({ title: bookTitle, author_id: parseInt(bookAuthorId, 10) }), + }) + .then(response => response.json()) + .then(() => { + loadBooks(); // Ponowne ładowanie listy książek po dodaniu nowej książki + }) + .catch(error => console.error('Error:', error)); +}); + +function loadAuthors() { + fetch(`${BASE_URL}/authors/`) + .then(response => response.json()) + .then(data => { + const authorsSelect = document.getElementById('bookAuthorId'); + authorsSelect.innerHTML = ''; // Dodaj domyślną opcję + data.forEach(author => { + const option = document.createElement('option'); + option.value = author.id; + option.textContent = author.name; + authorsSelect.appendChild(option); + }); + }) + .catch(error => console.error('Error:', error)); +} + +function loadBooks() { + fetch(`${BASE_URL}/books/`) + .then(response => response.json()) + .then(data => { + const booksList = document.getElementById('booksList'); + booksList.innerHTML = ''; + data.forEach(book => { + const listItem = document.createElement('li'); + listItem.textContent = `${book.title} - Author ID: ${book.author_id}`; + booksList.appendChild(listItem); + }); + }) + .catch(error => console.error('Error:', error)); +} + diff --git a/static/style.css b/static/style.css new file mode 100644 index 0000000..3883254 --- /dev/null +++ b/static/style.css @@ -0,0 +1,43 @@ +body, html { + margin: 0; + padding: 0; + font-family: Arial, sans-serif; +} + +header, footer { + background-color: #333; + color: #fff; + text-align: center; + padding: 1rem 0; +} + +.container { + display: flex; + min-height: calc(100vh - 100px); /* Adjust based on header/footer height */ +} + +.sidebar { + width: 30%; + padding: 20px; + background-color: #f4f4f4; +} + +.content { + flex-grow: 1; + padding: 20px; +} + +form > * { + display: block; + margin-bottom: 10px; +} + +button { + cursor: pointer; +} + +ul { + list-style-type: none; + padding-left: 0; +} + diff --git a/static/vue.global.js b/static/vue.global.js new file mode 100644 index 0000000..ccecf3c --- /dev/null +++ b/static/vue.global.js @@ -0,0 +1,16733 @@ +/** +* vue v3.4.29 +* (c) 2018-present Yuxi (Evan) You and Vue contributors +* @license MIT +**/ +var Vue = (function (exports) { + 'use strict'; + + /*! #__NO_SIDE_EFFECTS__ */ + // @__NO_SIDE_EFFECTS__ + function makeMap(str, expectsLowerCase) { + const set = new Set(str.split(",")); + return expectsLowerCase ? (val) => set.has(val.toLowerCase()) : (val) => set.has(val); + } + + const EMPTY_OBJ = Object.freeze({}) ; + const EMPTY_ARR = Object.freeze([]) ; + const NOOP = () => { + }; + const NO = () => false; + const isOn = (key) => key.charCodeAt(0) === 111 && key.charCodeAt(1) === 110 && // uppercase letter + (key.charCodeAt(2) > 122 || key.charCodeAt(2) < 97); + const isModelListener = (key) => key.startsWith("onUpdate:"); + const extend = Object.assign; + const remove = (arr, el) => { + const i = arr.indexOf(el); + if (i > -1) { + arr.splice(i, 1); + } + }; + const hasOwnProperty$1 = Object.prototype.hasOwnProperty; + const hasOwn = (val, key) => hasOwnProperty$1.call(val, key); + const isArray = Array.isArray; + const isMap = (val) => toTypeString(val) === "[object Map]"; + const isSet = (val) => toTypeString(val) === "[object Set]"; + const isDate = (val) => toTypeString(val) === "[object Date]"; + const isRegExp = (val) => toTypeString(val) === "[object RegExp]"; + const isFunction = (val) => typeof val === "function"; + const isString = (val) => typeof val === "string"; + const isSymbol = (val) => typeof val === "symbol"; + const isObject = (val) => val !== null && typeof val === "object"; + const isPromise = (val) => { + return (isObject(val) || isFunction(val)) && isFunction(val.then) && isFunction(val.catch); + }; + const objectToString = Object.prototype.toString; + const toTypeString = (value) => objectToString.call(value); + const toRawType = (value) => { + return toTypeString(value).slice(8, -1); + }; + const isPlainObject = (val) => toTypeString(val) === "[object Object]"; + const isIntegerKey = (key) => isString(key) && key !== "NaN" && key[0] !== "-" && "" + parseInt(key, 10) === key; + const isReservedProp = /* @__PURE__ */ makeMap( + // the leading comma is intentional so empty string "" is also included + ",key,ref,ref_for,ref_key,onVnodeBeforeMount,onVnodeMounted,onVnodeBeforeUpdate,onVnodeUpdated,onVnodeBeforeUnmount,onVnodeUnmounted" + ); + const isBuiltInDirective = /* @__PURE__ */ makeMap( + "bind,cloak,else-if,else,for,html,if,model,on,once,pre,show,slot,text,memo" + ); + const cacheStringFunction = (fn) => { + const cache = /* @__PURE__ */ Object.create(null); + return (str) => { + const hit = cache[str]; + return hit || (cache[str] = fn(str)); + }; + }; + const camelizeRE = /-(\w)/g; + const camelize = cacheStringFunction((str) => { + return str.replace(camelizeRE, (_, c) => c ? c.toUpperCase() : ""); + }); + const hyphenateRE = /\B([A-Z])/g; + const hyphenate = cacheStringFunction( + (str) => str.replace(hyphenateRE, "-$1").toLowerCase() + ); + const capitalize = cacheStringFunction((str) => { + return str.charAt(0).toUpperCase() + str.slice(1); + }); + const toHandlerKey = cacheStringFunction((str) => { + const s = str ? `on${capitalize(str)}` : ``; + return s; + }); + const hasChanged = (value, oldValue) => !Object.is(value, oldValue); + const invokeArrayFns = (fns, ...arg) => { + for (let i = 0; i < fns.length; i++) { + fns[i](...arg); + } + }; + const def = (obj, key, value, writable = false) => { + Object.defineProperty(obj, key, { + configurable: true, + enumerable: false, + writable, + value + }); + }; + const looseToNumber = (val) => { + const n = parseFloat(val); + return isNaN(n) ? val : n; + }; + const toNumber = (val) => { + const n = isString(val) ? Number(val) : NaN; + return isNaN(n) ? val : n; + }; + let _globalThis; + const getGlobalThis = () => { + return _globalThis || (_globalThis = typeof globalThis !== "undefined" ? globalThis : typeof self !== "undefined" ? self : typeof window !== "undefined" ? window : typeof global !== "undefined" ? global : {}); + }; + + const PatchFlagNames = { + [1]: `TEXT`, + [2]: `CLASS`, + [4]: `STYLE`, + [8]: `PROPS`, + [16]: `FULL_PROPS`, + [32]: `NEED_HYDRATION`, + [64]: `STABLE_FRAGMENT`, + [128]: `KEYED_FRAGMENT`, + [256]: `UNKEYED_FRAGMENT`, + [512]: `NEED_PATCH`, + [1024]: `DYNAMIC_SLOTS`, + [2048]: `DEV_ROOT_FRAGMENT`, + [-1]: `HOISTED`, + [-2]: `BAIL` + }; + + const slotFlagsText = { + [1]: "STABLE", + [2]: "DYNAMIC", + [3]: "FORWARDED" + }; + + const GLOBALS_ALLOWED = "Infinity,undefined,NaN,isFinite,isNaN,parseFloat,parseInt,decodeURI,decodeURIComponent,encodeURI,encodeURIComponent,Math,Number,Date,Array,Object,Boolean,String,RegExp,Map,Set,JSON,Intl,BigInt,console,Error"; + const isGloballyAllowed = /* @__PURE__ */ makeMap(GLOBALS_ALLOWED); + + const range = 2; + function generateCodeFrame(source, start = 0, end = source.length) { + start = Math.max(0, Math.min(start, source.length)); + end = Math.max(0, Math.min(end, source.length)); + if (start > end) return ""; + let lines = source.split(/(\r?\n)/); + const newlineSequences = lines.filter((_, idx) => idx % 2 === 1); + lines = lines.filter((_, idx) => idx % 2 === 0); + let count = 0; + const res = []; + for (let i = 0; i < lines.length; i++) { + count += lines[i].length + (newlineSequences[i] && newlineSequences[i].length || 0); + if (count >= start) { + for (let j = i - range; j <= i + range || end > count; j++) { + if (j < 0 || j >= lines.length) continue; + const line = j + 1; + res.push( + `${line}${" ".repeat(Math.max(3 - String(line).length, 0))}| ${lines[j]}` + ); + const lineLength = lines[j].length; + const newLineSeqLength = newlineSequences[j] && newlineSequences[j].length || 0; + if (j === i) { + const pad = start - (count - (lineLength + newLineSeqLength)); + const length = Math.max( + 1, + end > count ? lineLength - pad : end - start + ); + res.push(` | ` + " ".repeat(pad) + "^".repeat(length)); + } else if (j > i) { + if (end > count) { + const length = Math.max(Math.min(end - count, lineLength), 1); + res.push(` | ` + "^".repeat(length)); + } + count += lineLength + newLineSeqLength; + } + } + break; + } + } + return res.join("\n"); + } + + function normalizeStyle(value) { + if (isArray(value)) { + const res = {}; + for (let i = 0; i < value.length; i++) { + const item = value[i]; + const normalized = isString(item) ? parseStringStyle(item) : normalizeStyle(item); + if (normalized) { + for (const key in normalized) { + res[key] = normalized[key]; + } + } + } + return res; + } else if (isString(value) || isObject(value)) { + return value; + } + } + const listDelimiterRE = /;(?![^(]*\))/g; + const propertyDelimiterRE = /:([^]+)/; + const styleCommentRE = /\/\*[^]*?\*\//g; + function parseStringStyle(cssText) { + const ret = {}; + cssText.replace(styleCommentRE, "").split(listDelimiterRE).forEach((item) => { + if (item) { + const tmp = item.split(propertyDelimiterRE); + tmp.length > 1 && (ret[tmp[0].trim()] = tmp[1].trim()); + } + }); + return ret; + } + function stringifyStyle(styles) { + let ret = ""; + if (!styles || isString(styles)) { + return ret; + } + for (const key in styles) { + const value = styles[key]; + if (isString(value) || typeof value === "number") { + const normalizedKey = key.startsWith(`--`) ? key : hyphenate(key); + ret += `${normalizedKey}:${value};`; + } + } + return ret; + } + function normalizeClass(value) { + let res = ""; + if (isString(value)) { + res = value; + } else if (isArray(value)) { + for (let i = 0; i < value.length; i++) { + const normalized = normalizeClass(value[i]); + if (normalized) { + res += normalized + " "; + } + } + } else if (isObject(value)) { + for (const name in value) { + if (value[name]) { + res += name + " "; + } + } + } + return res.trim(); + } + function normalizeProps(props) { + if (!props) return null; + let { class: klass, style } = props; + if (klass && !isString(klass)) { + props.class = normalizeClass(klass); + } + if (style) { + props.style = normalizeStyle(style); + } + return props; + } + + const HTML_TAGS = "html,body,base,head,link,meta,style,title,address,article,aside,footer,header,hgroup,h1,h2,h3,h4,h5,h6,nav,section,div,dd,dl,dt,figcaption,figure,picture,hr,img,li,main,ol,p,pre,ul,a,b,abbr,bdi,bdo,br,cite,code,data,dfn,em,i,kbd,mark,q,rp,rt,ruby,s,samp,small,span,strong,sub,sup,time,u,var,wbr,area,audio,map,track,video,embed,object,param,source,canvas,script,noscript,del,ins,caption,col,colgroup,table,thead,tbody,td,th,tr,button,datalist,fieldset,form,input,label,legend,meter,optgroup,option,output,progress,select,textarea,details,dialog,menu,summary,template,blockquote,iframe,tfoot"; + const SVG_TAGS = "svg,animate,animateMotion,animateTransform,circle,clipPath,color-profile,defs,desc,discard,ellipse,feBlend,feColorMatrix,feComponentTransfer,feComposite,feConvolveMatrix,feDiffuseLighting,feDisplacementMap,feDistantLight,feDropShadow,feFlood,feFuncA,feFuncB,feFuncG,feFuncR,feGaussianBlur,feImage,feMerge,feMergeNode,feMorphology,feOffset,fePointLight,feSpecularLighting,feSpotLight,feTile,feTurbulence,filter,foreignObject,g,hatch,hatchpath,image,line,linearGradient,marker,mask,mesh,meshgradient,meshpatch,meshrow,metadata,mpath,path,pattern,polygon,polyline,radialGradient,rect,set,solidcolor,stop,switch,symbol,text,textPath,title,tspan,unknown,use,view"; + const MATH_TAGS = "annotation,annotation-xml,maction,maligngroup,malignmark,math,menclose,merror,mfenced,mfrac,mfraction,mglyph,mi,mlabeledtr,mlongdiv,mmultiscripts,mn,mo,mover,mpadded,mphantom,mprescripts,mroot,mrow,ms,mscarries,mscarry,msgroup,msline,mspace,msqrt,msrow,mstack,mstyle,msub,msubsup,msup,mtable,mtd,mtext,mtr,munder,munderover,none,semantics"; + const VOID_TAGS = "area,base,br,col,embed,hr,img,input,link,meta,param,source,track,wbr"; + const isHTMLTag = /* @__PURE__ */ makeMap(HTML_TAGS); + const isSVGTag = /* @__PURE__ */ makeMap(SVG_TAGS); + const isMathMLTag = /* @__PURE__ */ makeMap(MATH_TAGS); + const isVoidTag = /* @__PURE__ */ makeMap(VOID_TAGS); + + const specialBooleanAttrs = `itemscope,allowfullscreen,formnovalidate,ismap,nomodule,novalidate,readonly`; + const isSpecialBooleanAttr = /* @__PURE__ */ makeMap(specialBooleanAttrs); + const isBooleanAttr = /* @__PURE__ */ makeMap( + specialBooleanAttrs + `,async,autofocus,autoplay,controls,default,defer,disabled,hidden,inert,loop,open,required,reversed,scoped,seamless,checked,muted,multiple,selected` + ); + function includeBooleanAttr(value) { + return !!value || value === ""; + } + const isKnownHtmlAttr = /* @__PURE__ */ makeMap( + `accept,accept-charset,accesskey,action,align,allow,alt,async,autocapitalize,autocomplete,autofocus,autoplay,background,bgcolor,border,buffered,capture,challenge,charset,checked,cite,class,code,codebase,color,cols,colspan,content,contenteditable,contextmenu,controls,coords,crossorigin,csp,data,datetime,decoding,default,defer,dir,dirname,disabled,download,draggable,dropzone,enctype,enterkeyhint,for,form,formaction,formenctype,formmethod,formnovalidate,formtarget,headers,height,hidden,high,href,hreflang,http-equiv,icon,id,importance,inert,integrity,ismap,itemprop,keytype,kind,label,lang,language,loading,list,loop,low,manifest,max,maxlength,minlength,media,min,multiple,muted,name,novalidate,open,optimum,pattern,ping,placeholder,poster,preload,radiogroup,readonly,referrerpolicy,rel,required,reversed,rows,rowspan,sandbox,scope,scoped,selected,shape,size,sizes,slot,span,spellcheck,src,srcdoc,srclang,srcset,start,step,style,summary,tabindex,target,title,translate,type,usemap,value,width,wrap` + ); + const isKnownSvgAttr = /* @__PURE__ */ makeMap( + `xmlns,accent-height,accumulate,additive,alignment-baseline,alphabetic,amplitude,arabic-form,ascent,attributeName,attributeType,azimuth,baseFrequency,baseline-shift,baseProfile,bbox,begin,bias,by,calcMode,cap-height,class,clip,clipPathUnits,clip-path,clip-rule,color,color-interpolation,color-interpolation-filters,color-profile,color-rendering,contentScriptType,contentStyleType,crossorigin,cursor,cx,cy,d,decelerate,descent,diffuseConstant,direction,display,divisor,dominant-baseline,dur,dx,dy,edgeMode,elevation,enable-background,end,exponent,fill,fill-opacity,fill-rule,filter,filterRes,filterUnits,flood-color,flood-opacity,font-family,font-size,font-size-adjust,font-stretch,font-style,font-variant,font-weight,format,from,fr,fx,fy,g1,g2,glyph-name,glyph-orientation-horizontal,glyph-orientation-vertical,glyphRef,gradientTransform,gradientUnits,hanging,height,href,hreflang,horiz-adv-x,horiz-origin-x,id,ideographic,image-rendering,in,in2,intercept,k,k1,k2,k3,k4,kernelMatrix,kernelUnitLength,kerning,keyPoints,keySplines,keyTimes,lang,lengthAdjust,letter-spacing,lighting-color,limitingConeAngle,local,marker-end,marker-mid,marker-start,markerHeight,markerUnits,markerWidth,mask,maskContentUnits,maskUnits,mathematical,max,media,method,min,mode,name,numOctaves,offset,opacity,operator,order,orient,orientation,origin,overflow,overline-position,overline-thickness,panose-1,paint-order,path,pathLength,patternContentUnits,patternTransform,patternUnits,ping,pointer-events,points,pointsAtX,pointsAtY,pointsAtZ,preserveAlpha,preserveAspectRatio,primitiveUnits,r,radius,referrerPolicy,refX,refY,rel,rendering-intent,repeatCount,repeatDur,requiredExtensions,requiredFeatures,restart,result,rotate,rx,ry,scale,seed,shape-rendering,slope,spacing,specularConstant,specularExponent,speed,spreadMethod,startOffset,stdDeviation,stemh,stemv,stitchTiles,stop-color,stop-opacity,strikethrough-position,strikethrough-thickness,string,stroke,stroke-dasharray,stroke-dashoffset,stroke-linecap,stroke-linejoin,stroke-miterlimit,stroke-opacity,stroke-width,style,surfaceScale,systemLanguage,tabindex,tableValues,target,targetX,targetY,text-anchor,text-decoration,text-rendering,textLength,to,transform,transform-origin,type,u1,u2,underline-position,underline-thickness,unicode,unicode-bidi,unicode-range,units-per-em,v-alphabetic,v-hanging,v-ideographic,v-mathematical,values,vector-effect,version,vert-adv-y,vert-origin-x,vert-origin-y,viewBox,viewTarget,visibility,width,widths,word-spacing,writing-mode,x,x-height,x1,x2,xChannelSelector,xlink:actuate,xlink:arcrole,xlink:href,xlink:role,xlink:show,xlink:title,xlink:type,xmlns:xlink,xml:base,xml:lang,xml:space,y,y1,y2,yChannelSelector,z,zoomAndPan` + ); + function isRenderableAttrValue(value) { + if (value == null) { + return false; + } + const type = typeof value; + return type === "string" || type === "number" || type === "boolean"; + } + + function looseCompareArrays(a, b) { + if (a.length !== b.length) return false; + let equal = true; + for (let i = 0; equal && i < a.length; i++) { + equal = looseEqual(a[i], b[i]); + } + return equal; + } + function looseEqual(a, b) { + if (a === b) return true; + let aValidType = isDate(a); + let bValidType = isDate(b); + if (aValidType || bValidType) { + return aValidType && bValidType ? a.getTime() === b.getTime() : false; + } + aValidType = isSymbol(a); + bValidType = isSymbol(b); + if (aValidType || bValidType) { + return a === b; + } + aValidType = isArray(a); + bValidType = isArray(b); + if (aValidType || bValidType) { + return aValidType && bValidType ? looseCompareArrays(a, b) : false; + } + aValidType = isObject(a); + bValidType = isObject(b); + if (aValidType || bValidType) { + if (!aValidType || !bValidType) { + return false; + } + const aKeysCount = Object.keys(a).length; + const bKeysCount = Object.keys(b).length; + if (aKeysCount !== bKeysCount) { + return false; + } + for (const key in a) { + const aHasKey = a.hasOwnProperty(key); + const bHasKey = b.hasOwnProperty(key); + if (aHasKey && !bHasKey || !aHasKey && bHasKey || !looseEqual(a[key], b[key])) { + return false; + } + } + } + return String(a) === String(b); + } + function looseIndexOf(arr, val) { + return arr.findIndex((item) => looseEqual(item, val)); + } + + const toDisplayString = (val) => { + return isString(val) ? val : val == null ? "" : isArray(val) || isObject(val) && (val.toString === objectToString || !isFunction(val.toString)) ? JSON.stringify(val, replacer, 2) : String(val); + }; + const replacer = (_key, val) => { + if (val && val.__v_isRef) { + return replacer(_key, val.value); + } else if (isMap(val)) { + return { + [`Map(${val.size})`]: [...val.entries()].reduce( + (entries, [key, val2], i) => { + entries[stringifySymbol(key, i) + " =>"] = val2; + return entries; + }, + {} + ) + }; + } else if (isSet(val)) { + return { + [`Set(${val.size})`]: [...val.values()].map((v) => stringifySymbol(v)) + }; + } else if (isSymbol(val)) { + return stringifySymbol(val); + } else if (isObject(val) && !isArray(val) && !isPlainObject(val)) { + return String(val); + } + return val; + }; + const stringifySymbol = (v, i = "") => { + var _a; + return ( + // Symbol.description in es2019+ so we need to cast here to pass + // the lib: es2016 check + isSymbol(v) ? `Symbol(${(_a = v.description) != null ? _a : i})` : v + ); + }; + + function warn$2(msg, ...args) { + console.warn(`[Vue warn] ${msg}`, ...args); + } + + let activeEffectScope; + class EffectScope { + constructor(detached = false) { + this.detached = detached; + /** + * @internal + */ + this._active = true; + /** + * @internal + */ + this.effects = []; + /** + * @internal + */ + this.cleanups = []; + this.parent = activeEffectScope; + if (!detached && activeEffectScope) { + this.index = (activeEffectScope.scopes || (activeEffectScope.scopes = [])).push( + this + ) - 1; + } + } + get active() { + return this._active; + } + run(fn) { + if (this._active) { + const currentEffectScope = activeEffectScope; + try { + activeEffectScope = this; + return fn(); + } finally { + activeEffectScope = currentEffectScope; + } + } else { + warn$2(`cannot run an inactive effect scope.`); + } + } + /** + * This should only be called on non-detached scopes + * @internal + */ + on() { + activeEffectScope = this; + } + /** + * This should only be called on non-detached scopes + * @internal + */ + off() { + activeEffectScope = this.parent; + } + stop(fromParent) { + if (this._active) { + let i, l; + for (i = 0, l = this.effects.length; i < l; i++) { + this.effects[i].stop(); + } + for (i = 0, l = this.cleanups.length; i < l; i++) { + this.cleanups[i](); + } + if (this.scopes) { + for (i = 0, l = this.scopes.length; i < l; i++) { + this.scopes[i].stop(true); + } + } + if (!this.detached && this.parent && !fromParent) { + const last = this.parent.scopes.pop(); + if (last && last !== this) { + this.parent.scopes[this.index] = last; + last.index = this.index; + } + } + this.parent = void 0; + this._active = false; + } + } + } + function effectScope(detached) { + return new EffectScope(detached); + } + function recordEffectScope(effect, scope = activeEffectScope) { + if (scope && scope.active) { + scope.effects.push(effect); + } + } + function getCurrentScope() { + return activeEffectScope; + } + function onScopeDispose(fn) { + if (activeEffectScope) { + activeEffectScope.cleanups.push(fn); + } else { + warn$2( + `onScopeDispose() is called when there is no active effect scope to be associated with.` + ); + } + } + + let activeEffect; + class ReactiveEffect { + constructor(fn, trigger, scheduler, scope) { + this.fn = fn; + this.trigger = trigger; + this.scheduler = scheduler; + this.active = true; + this.deps = []; + /** + * @internal + */ + this._dirtyLevel = 5; + /** + * @internal + */ + this._trackId = 0; + /** + * @internal + */ + this._runnings = 0; + /** + * @internal + */ + this._shouldSchedule = false; + /** + * @internal + */ + this._depsLength = 0; + recordEffectScope(this, scope); + } + get dirty() { + if (this._dirtyLevel === 2) + return false; + if (this._dirtyLevel === 3 || this._dirtyLevel === 4) { + this._dirtyLevel = 1; + pauseTracking(); + for (let i = 0; i < this._depsLength; i++) { + const dep = this.deps[i]; + if (dep.computed) { + if (dep.computed.effect._dirtyLevel === 2) + return true; + triggerComputed(dep.computed); + if (this._dirtyLevel >= 5) { + break; + } + } + } + if (this._dirtyLevel === 1) { + this._dirtyLevel = 0; + } + resetTracking(); + } + return this._dirtyLevel >= 5; + } + set dirty(v) { + this._dirtyLevel = v ? 5 : 0; + } + run() { + this._dirtyLevel = 0; + if (!this.active) { + return this.fn(); + } + let lastShouldTrack = shouldTrack; + let lastEffect = activeEffect; + try { + shouldTrack = true; + activeEffect = this; + this._runnings++; + preCleanupEffect(this); + return this.fn(); + } finally { + postCleanupEffect(this); + this._runnings--; + activeEffect = lastEffect; + shouldTrack = lastShouldTrack; + } + } + stop() { + if (this.active) { + preCleanupEffect(this); + postCleanupEffect(this); + this.onStop && this.onStop(); + this.active = false; + } + } + } + function triggerComputed(computed) { + return computed.value; + } + function preCleanupEffect(effect2) { + effect2._trackId++; + effect2._depsLength = 0; + } + function postCleanupEffect(effect2) { + if (effect2.deps.length > effect2._depsLength) { + for (let i = effect2._depsLength; i < effect2.deps.length; i++) { + cleanupDepEffect(effect2.deps[i], effect2); + } + effect2.deps.length = effect2._depsLength; + } + } + function cleanupDepEffect(dep, effect2) { + const trackId = dep.get(effect2); + if (trackId !== void 0 && effect2._trackId !== trackId) { + dep.delete(effect2); + if (dep.size === 0) { + dep.cleanup(); + } + } + } + function effect(fn, options) { + if (fn.effect instanceof ReactiveEffect) { + fn = fn.effect.fn; + } + const _effect = new ReactiveEffect(fn, NOOP, () => { + if (_effect.dirty) { + _effect.run(); + } + }); + if (options) { + extend(_effect, options); + if (options.scope) recordEffectScope(_effect, options.scope); + } + if (!options || !options.lazy) { + _effect.run(); + } + const runner = _effect.run.bind(_effect); + runner.effect = _effect; + return runner; + } + function stop(runner) { + runner.effect.stop(); + } + let shouldTrack = true; + let pauseScheduleStack = 0; + const trackStack = []; + function pauseTracking() { + trackStack.push(shouldTrack); + shouldTrack = false; + } + function resetTracking() { + const last = trackStack.pop(); + shouldTrack = last === void 0 ? true : last; + } + function pauseScheduling() { + pauseScheduleStack++; + } + function resetScheduling() { + pauseScheduleStack--; + while (!pauseScheduleStack && queueEffectSchedulers.length) { + queueEffectSchedulers.shift()(); + } + } + function trackEffect(effect2, dep, debuggerEventExtraInfo) { + var _a; + if (dep.get(effect2) !== effect2._trackId) { + dep.set(effect2, effect2._trackId); + const oldDep = effect2.deps[effect2._depsLength]; + if (oldDep !== dep) { + if (oldDep) { + cleanupDepEffect(oldDep, effect2); + } + effect2.deps[effect2._depsLength++] = dep; + } else { + effect2._depsLength++; + } + { + (_a = effect2.onTrack) == null ? void 0 : _a.call(effect2, extend({ effect: effect2 }, debuggerEventExtraInfo)); + } + } + } + const queueEffectSchedulers = []; + function triggerEffects(dep, dirtyLevel, debuggerEventExtraInfo) { + var _a; + pauseScheduling(); + for (const effect2 of dep.keys()) { + if (!dep.computed && effect2.computed) { + if (dep.get(effect2) === effect2._trackId && effect2._runnings > 0) { + effect2._dirtyLevel = 2; + continue; + } + } + let tracking; + if (effect2._dirtyLevel < dirtyLevel && (tracking != null ? tracking : tracking = dep.get(effect2) === effect2._trackId)) { + effect2._shouldSchedule || (effect2._shouldSchedule = effect2._dirtyLevel === 0); + if (effect2.computed && effect2._dirtyLevel === 2) { + effect2._shouldSchedule = true; + } + effect2._dirtyLevel = dirtyLevel; + } + if (effect2._shouldSchedule && (tracking != null ? tracking : tracking = dep.get(effect2) === effect2._trackId)) { + { + (_a = effect2.onTrigger) == null ? void 0 : _a.call(effect2, extend({ effect: effect2 }, debuggerEventExtraInfo)); + } + effect2.trigger(); + if ((!effect2._runnings || effect2.allowRecurse) && effect2._dirtyLevel !== 3) { + effect2._shouldSchedule = false; + if (effect2.scheduler) { + queueEffectSchedulers.push(effect2.scheduler); + } + } + } + } + resetScheduling(); + } + + const createDep = (cleanup, computed) => { + const dep = /* @__PURE__ */ new Map(); + dep.cleanup = cleanup; + dep.computed = computed; + return dep; + }; + + const targetMap = /* @__PURE__ */ new WeakMap(); + const ITERATE_KEY = Symbol("iterate" ); + const MAP_KEY_ITERATE_KEY = Symbol("Map key iterate" ); + function track(target, type, key) { + if (shouldTrack && activeEffect) { + let depsMap = targetMap.get(target); + if (!depsMap) { + targetMap.set(target, depsMap = /* @__PURE__ */ new Map()); + } + let dep = depsMap.get(key); + if (!dep) { + depsMap.set(key, dep = createDep(() => depsMap.delete(key))); + } + trackEffect( + activeEffect, + dep, + { + target, + type, + key + } + ); + } + } + function trigger(target, type, key, newValue, oldValue, oldTarget) { + const depsMap = targetMap.get(target); + if (!depsMap) { + return; + } + let deps = []; + if (type === "clear") { + deps = [...depsMap.values()]; + } else if (key === "length" && isArray(target)) { + const newLength = Number(newValue); + depsMap.forEach((dep, key2) => { + if (key2 === "length" || !isSymbol(key2) && key2 >= newLength) { + deps.push(dep); + } + }); + } else { + if (key !== void 0) { + deps.push(depsMap.get(key)); + } + switch (type) { + case "add": + if (!isArray(target)) { + deps.push(depsMap.get(ITERATE_KEY)); + if (isMap(target)) { + deps.push(depsMap.get(MAP_KEY_ITERATE_KEY)); + } + } else if (isIntegerKey(key)) { + deps.push(depsMap.get("length")); + } + break; + case "delete": + if (!isArray(target)) { + deps.push(depsMap.get(ITERATE_KEY)); + if (isMap(target)) { + deps.push(depsMap.get(MAP_KEY_ITERATE_KEY)); + } + } + break; + case "set": + if (isMap(target)) { + deps.push(depsMap.get(ITERATE_KEY)); + } + break; + } + } + pauseScheduling(); + for (const dep of deps) { + if (dep) { + triggerEffects( + dep, + 5, + { + target, + type, + key, + newValue, + oldValue, + oldTarget + } + ); + } + } + resetScheduling(); + } + function getDepFromReactive(object, key) { + const depsMap = targetMap.get(object); + return depsMap && depsMap.get(key); + } + + const isNonTrackableKeys = /* @__PURE__ */ makeMap(`__proto__,__v_isRef,__isVue`); + const builtInSymbols = new Set( + /* @__PURE__ */ Object.getOwnPropertyNames(Symbol).filter((key) => key !== "arguments" && key !== "caller").map((key) => Symbol[key]).filter(isSymbol) + ); + const arrayInstrumentations = /* @__PURE__ */ createArrayInstrumentations(); + function createArrayInstrumentations() { + const instrumentations = {}; + ["includes", "indexOf", "lastIndexOf"].forEach((key) => { + instrumentations[key] = function(...args) { + const arr = toRaw(this); + for (let i = 0, l = this.length; i < l; i++) { + track(arr, "get", i + ""); + } + const res = arr[key](...args); + if (res === -1 || res === false) { + return arr[key](...args.map(toRaw)); + } else { + return res; + } + }; + }); + ["push", "pop", "shift", "unshift", "splice"].forEach((key) => { + instrumentations[key] = function(...args) { + pauseTracking(); + pauseScheduling(); + const res = toRaw(this)[key].apply(this, args); + resetScheduling(); + resetTracking(); + return res; + }; + }); + return instrumentations; + } + function hasOwnProperty(key) { + if (!isSymbol(key)) key = String(key); + const obj = toRaw(this); + track(obj, "has", key); + return obj.hasOwnProperty(key); + } + class BaseReactiveHandler { + constructor(_isReadonly = false, _isShallow = false) { + this._isReadonly = _isReadonly; + this._isShallow = _isShallow; + } + get(target, key, receiver) { + const isReadonly2 = this._isReadonly, isShallow2 = this._isShallow; + if (key === "__v_isReactive") { + return !isReadonly2; + } else if (key === "__v_isReadonly") { + return isReadonly2; + } else if (key === "__v_isShallow") { + return isShallow2; + } else if (key === "__v_raw") { + if (receiver === (isReadonly2 ? isShallow2 ? shallowReadonlyMap : readonlyMap : isShallow2 ? shallowReactiveMap : reactiveMap).get(target) || // receiver is not the reactive proxy, but has the same prototype + // this means the reciever is a user proxy of the reactive proxy + Object.getPrototypeOf(target) === Object.getPrototypeOf(receiver)) { + return target; + } + return; + } + const targetIsArray = isArray(target); + if (!isReadonly2) { + if (targetIsArray && hasOwn(arrayInstrumentations, key)) { + return Reflect.get(arrayInstrumentations, key, receiver); + } + if (key === "hasOwnProperty") { + return hasOwnProperty; + } + } + const res = Reflect.get(target, key, receiver); + if (isSymbol(key) ? builtInSymbols.has(key) : isNonTrackableKeys(key)) { + return res; + } + if (!isReadonly2) { + track(target, "get", key); + } + if (isShallow2) { + return res; + } + if (isRef(res)) { + return targetIsArray && isIntegerKey(key) ? res : res.value; + } + if (isObject(res)) { + return isReadonly2 ? readonly(res) : reactive(res); + } + return res; + } + } + class MutableReactiveHandler extends BaseReactiveHandler { + constructor(isShallow2 = false) { + super(false, isShallow2); + } + set(target, key, value, receiver) { + let oldValue = target[key]; + if (!this._isShallow) { + const isOldValueReadonly = isReadonly(oldValue); + if (!isShallow(value) && !isReadonly(value)) { + oldValue = toRaw(oldValue); + value = toRaw(value); + } + if (!isArray(target) && isRef(oldValue) && !isRef(value)) { + if (isOldValueReadonly) { + return false; + } else { + oldValue.value = value; + return true; + } + } + } + const hadKey = isArray(target) && isIntegerKey(key) ? Number(key) < target.length : hasOwn(target, key); + const result = Reflect.set(target, key, value, receiver); + if (target === toRaw(receiver)) { + if (!hadKey) { + trigger(target, "add", key, value); + } else if (hasChanged(value, oldValue)) { + trigger(target, "set", key, value, oldValue); + } + } + return result; + } + deleteProperty(target, key) { + const hadKey = hasOwn(target, key); + const oldValue = target[key]; + const result = Reflect.deleteProperty(target, key); + if (result && hadKey) { + trigger(target, "delete", key, void 0, oldValue); + } + return result; + } + has(target, key) { + const result = Reflect.has(target, key); + if (!isSymbol(key) || !builtInSymbols.has(key)) { + track(target, "has", key); + } + return result; + } + ownKeys(target) { + track( + target, + "iterate", + isArray(target) ? "length" : ITERATE_KEY + ); + return Reflect.ownKeys(target); + } + } + class ReadonlyReactiveHandler extends BaseReactiveHandler { + constructor(isShallow2 = false) { + super(true, isShallow2); + } + set(target, key) { + { + warn$2( + `Set operation on key "${String(key)}" failed: target is readonly.`, + target + ); + } + return true; + } + deleteProperty(target, key) { + { + warn$2( + `Delete operation on key "${String(key)}" failed: target is readonly.`, + target + ); + } + return true; + } + } + const mutableHandlers = /* @__PURE__ */ new MutableReactiveHandler(); + const readonlyHandlers = /* @__PURE__ */ new ReadonlyReactiveHandler(); + const shallowReactiveHandlers = /* @__PURE__ */ new MutableReactiveHandler( + true + ); + const shallowReadonlyHandlers = /* @__PURE__ */ new ReadonlyReactiveHandler(true); + + const toShallow = (value) => value; + const getProto = (v) => Reflect.getPrototypeOf(v); + function get(target, key, isReadonly = false, isShallow = false) { + target = target["__v_raw"]; + const rawTarget = toRaw(target); + const rawKey = toRaw(key); + if (!isReadonly) { + if (hasChanged(key, rawKey)) { + track(rawTarget, "get", key); + } + track(rawTarget, "get", rawKey); + } + const { has: has2 } = getProto(rawTarget); + const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive; + if (has2.call(rawTarget, key)) { + return wrap(target.get(key)); + } else if (has2.call(rawTarget, rawKey)) { + return wrap(target.get(rawKey)); + } else if (target !== rawTarget) { + target.get(key); + } + } + function has(key, isReadonly = false) { + const target = this["__v_raw"]; + const rawTarget = toRaw(target); + const rawKey = toRaw(key); + if (!isReadonly) { + if (hasChanged(key, rawKey)) { + track(rawTarget, "has", key); + } + track(rawTarget, "has", rawKey); + } + return key === rawKey ? target.has(key) : target.has(key) || target.has(rawKey); + } + function size(target, isReadonly = false) { + target = target["__v_raw"]; + !isReadonly && track(toRaw(target), "iterate", ITERATE_KEY); + return Reflect.get(target, "size", target); + } + function add(value) { + value = toRaw(value); + const target = toRaw(this); + const proto = getProto(target); + const hadKey = proto.has.call(target, value); + if (!hadKey) { + target.add(value); + trigger(target, "add", value, value); + } + return this; + } + function set(key, value) { + value = toRaw(value); + const target = toRaw(this); + const { has: has2, get: get2 } = getProto(target); + let hadKey = has2.call(target, key); + if (!hadKey) { + key = toRaw(key); + hadKey = has2.call(target, key); + } else { + checkIdentityKeys(target, has2, key); + } + const oldValue = get2.call(target, key); + target.set(key, value); + if (!hadKey) { + trigger(target, "add", key, value); + } else if (hasChanged(value, oldValue)) { + trigger(target, "set", key, value, oldValue); + } + return this; + } + function deleteEntry(key) { + const target = toRaw(this); + const { has: has2, get: get2 } = getProto(target); + let hadKey = has2.call(target, key); + if (!hadKey) { + key = toRaw(key); + hadKey = has2.call(target, key); + } else { + checkIdentityKeys(target, has2, key); + } + const oldValue = get2 ? get2.call(target, key) : void 0; + const result = target.delete(key); + if (hadKey) { + trigger(target, "delete", key, void 0, oldValue); + } + return result; + } + function clear() { + const target = toRaw(this); + const hadItems = target.size !== 0; + const oldTarget = isMap(target) ? new Map(target) : new Set(target) ; + const result = target.clear(); + if (hadItems) { + trigger(target, "clear", void 0, void 0, oldTarget); + } + return result; + } + function createForEach(isReadonly, isShallow) { + return function forEach(callback, thisArg) { + const observed = this; + const target = observed["__v_raw"]; + const rawTarget = toRaw(target); + const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive; + !isReadonly && track(rawTarget, "iterate", ITERATE_KEY); + return target.forEach((value, key) => { + return callback.call(thisArg, wrap(value), wrap(key), observed); + }); + }; + } + function createIterableMethod(method, isReadonly, isShallow) { + return function(...args) { + const target = this["__v_raw"]; + const rawTarget = toRaw(target); + const targetIsMap = isMap(rawTarget); + const isPair = method === "entries" || method === Symbol.iterator && targetIsMap; + const isKeyOnly = method === "keys" && targetIsMap; + const innerIterator = target[method](...args); + const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive; + !isReadonly && track( + rawTarget, + "iterate", + isKeyOnly ? MAP_KEY_ITERATE_KEY : ITERATE_KEY + ); + return { + // iterator protocol + next() { + const { value, done } = innerIterator.next(); + return done ? { value, done } : { + value: isPair ? [wrap(value[0]), wrap(value[1])] : wrap(value), + done + }; + }, + // iterable protocol + [Symbol.iterator]() { + return this; + } + }; + }; + } + function createReadonlyMethod(type) { + return function(...args) { + { + const key = args[0] ? `on key "${args[0]}" ` : ``; + warn$2( + `${capitalize(type)} operation ${key}failed: target is readonly.`, + toRaw(this) + ); + } + return type === "delete" ? false : type === "clear" ? void 0 : this; + }; + } + function createInstrumentations() { + const mutableInstrumentations2 = { + get(key) { + return get(this, key); + }, + get size() { + return size(this); + }, + has, + add, + set, + delete: deleteEntry, + clear, + forEach: createForEach(false, false) + }; + const shallowInstrumentations2 = { + get(key) { + return get(this, key, false, true); + }, + get size() { + return size(this); + }, + has, + add, + set, + delete: deleteEntry, + clear, + forEach: createForEach(false, true) + }; + const readonlyInstrumentations2 = { + get(key) { + return get(this, key, true); + }, + get size() { + return size(this, true); + }, + has(key) { + return has.call(this, key, true); + }, + add: createReadonlyMethod("add"), + set: createReadonlyMethod("set"), + delete: createReadonlyMethod("delete"), + clear: createReadonlyMethod("clear"), + forEach: createForEach(true, false) + }; + const shallowReadonlyInstrumentations2 = { + get(key) { + return get(this, key, true, true); + }, + get size() { + return size(this, true); + }, + has(key) { + return has.call(this, key, true); + }, + add: createReadonlyMethod("add"), + set: createReadonlyMethod("set"), + delete: createReadonlyMethod("delete"), + clear: createReadonlyMethod("clear"), + forEach: createForEach(true, true) + }; + const iteratorMethods = [ + "keys", + "values", + "entries", + Symbol.iterator + ]; + iteratorMethods.forEach((method) => { + mutableInstrumentations2[method] = createIterableMethod(method, false, false); + readonlyInstrumentations2[method] = createIterableMethod(method, true, false); + shallowInstrumentations2[method] = createIterableMethod(method, false, true); + shallowReadonlyInstrumentations2[method] = createIterableMethod( + method, + true, + true + ); + }); + return [ + mutableInstrumentations2, + readonlyInstrumentations2, + shallowInstrumentations2, + shallowReadonlyInstrumentations2 + ]; + } + const [ + mutableInstrumentations, + readonlyInstrumentations, + shallowInstrumentations, + shallowReadonlyInstrumentations + ] = /* @__PURE__ */ createInstrumentations(); + function createInstrumentationGetter(isReadonly, shallow) { + const instrumentations = shallow ? isReadonly ? shallowReadonlyInstrumentations : shallowInstrumentations : isReadonly ? readonlyInstrumentations : mutableInstrumentations; + return (target, key, receiver) => { + if (key === "__v_isReactive") { + return !isReadonly; + } else if (key === "__v_isReadonly") { + return isReadonly; + } else if (key === "__v_raw") { + return target; + } + return Reflect.get( + hasOwn(instrumentations, key) && key in target ? instrumentations : target, + key, + receiver + ); + }; + } + const mutableCollectionHandlers = { + get: /* @__PURE__ */ createInstrumentationGetter(false, false) + }; + const shallowCollectionHandlers = { + get: /* @__PURE__ */ createInstrumentationGetter(false, true) + }; + const readonlyCollectionHandlers = { + get: /* @__PURE__ */ createInstrumentationGetter(true, false) + }; + const shallowReadonlyCollectionHandlers = { + get: /* @__PURE__ */ createInstrumentationGetter(true, true) + }; + function checkIdentityKeys(target, has2, key) { + const rawKey = toRaw(key); + if (rawKey !== key && has2.call(target, rawKey)) { + const type = toRawType(target); + warn$2( + `Reactive ${type} contains both the raw and reactive versions of the same object${type === `Map` ? ` as keys` : ``}, which can lead to inconsistencies. Avoid differentiating between the raw and reactive versions of an object and only use the reactive version if possible.` + ); + } + } + + const reactiveMap = /* @__PURE__ */ new WeakMap(); + const shallowReactiveMap = /* @__PURE__ */ new WeakMap(); + const readonlyMap = /* @__PURE__ */ new WeakMap(); + const shallowReadonlyMap = /* @__PURE__ */ new WeakMap(); + function targetTypeMap(rawType) { + switch (rawType) { + case "Object": + case "Array": + return 1 /* COMMON */; + case "Map": + case "Set": + case "WeakMap": + case "WeakSet": + return 2 /* COLLECTION */; + default: + return 0 /* INVALID */; + } + } + function getTargetType(value) { + return value["__v_skip"] || !Object.isExtensible(value) ? 0 /* INVALID */ : targetTypeMap(toRawType(value)); + } + function reactive(target) { + if (isReadonly(target)) { + return target; + } + return createReactiveObject( + target, + false, + mutableHandlers, + mutableCollectionHandlers, + reactiveMap + ); + } + function shallowReactive(target) { + return createReactiveObject( + target, + false, + shallowReactiveHandlers, + shallowCollectionHandlers, + shallowReactiveMap + ); + } + function readonly(target) { + return createReactiveObject( + target, + true, + readonlyHandlers, + readonlyCollectionHandlers, + readonlyMap + ); + } + function shallowReadonly(target) { + return createReactiveObject( + target, + true, + shallowReadonlyHandlers, + shallowReadonlyCollectionHandlers, + shallowReadonlyMap + ); + } + function createReactiveObject(target, isReadonly2, baseHandlers, collectionHandlers, proxyMap) { + if (!isObject(target)) { + { + warn$2( + `value cannot be made ${isReadonly2 ? "readonly" : "reactive"}: ${String( + target + )}` + ); + } + return target; + } + if (target["__v_raw"] && !(isReadonly2 && target["__v_isReactive"])) { + return target; + } + const existingProxy = proxyMap.get(target); + if (existingProxy) { + return existingProxy; + } + const targetType = getTargetType(target); + if (targetType === 0 /* INVALID */) { + return target; + } + const proxy = new Proxy( + target, + targetType === 2 /* COLLECTION */ ? collectionHandlers : baseHandlers + ); + proxyMap.set(target, proxy); + return proxy; + } + function isReactive(value) { + if (isReadonly(value)) { + return isReactive(value["__v_raw"]); + } + return !!(value && value["__v_isReactive"]); + } + function isReadonly(value) { + return !!(value && value["__v_isReadonly"]); + } + function isShallow(value) { + return !!(value && value["__v_isShallow"]); + } + function isProxy(value) { + return value ? !!value["__v_raw"] : false; + } + function toRaw(observed) { + const raw = observed && observed["__v_raw"]; + return raw ? toRaw(raw) : observed; + } + function markRaw(value) { + if (Object.isExtensible(value)) { + def(value, "__v_skip", true); + } + return value; + } + const toReactive = (value) => isObject(value) ? reactive(value) : value; + const toReadonly = (value) => isObject(value) ? readonly(value) : value; + + const COMPUTED_SIDE_EFFECT_WARN = `Computed is still dirty after getter evaluation, likely because a computed is mutating its own dependency in its getter. State mutations in computed getters should be avoided. Check the docs for more details: https://vuejs.org/guide/essentials/computed.html#getters-should-be-side-effect-free`; + class ComputedRefImpl { + constructor(getter, _setter, isReadonly, isSSR) { + this.getter = getter; + this._setter = _setter; + this.dep = void 0; + this.__v_isRef = true; + this["__v_isReadonly"] = false; + this.effect = new ReactiveEffect( + () => getter(this._value), + () => triggerRefValue( + this, + this.effect._dirtyLevel === 3 ? 3 : 4 + ) + ); + this.effect.computed = this; + this.effect.active = this._cacheable = !isSSR; + this["__v_isReadonly"] = isReadonly; + } + get value() { + const self = toRaw(this); + if ((!self._cacheable || self.effect.dirty) && hasChanged(self._value, self._value = self.effect.run())) { + triggerRefValue(self, 5); + } + trackRefValue(self); + if (self.effect._dirtyLevel >= 2) { + if (this._warnRecursive) { + warn$2(COMPUTED_SIDE_EFFECT_WARN, ` + +getter: `, this.getter); + } + triggerRefValue(self, 3); + } + return self._value; + } + set value(newValue) { + this._setter(newValue); + } + // #region polyfill _dirty for backward compatibility third party code for Vue <= 3.3.x + get _dirty() { + return this.effect.dirty; + } + set _dirty(v) { + this.effect.dirty = v; + } + // #endregion + } + function computed$1(getterOrOptions, debugOptions, isSSR = false) { + let getter; + let setter; + const onlyGetter = isFunction(getterOrOptions); + if (onlyGetter) { + getter = getterOrOptions; + setter = () => { + warn$2("Write operation failed: computed value is readonly"); + } ; + } else { + getter = getterOrOptions.get; + setter = getterOrOptions.set; + } + const cRef = new ComputedRefImpl(getter, setter, onlyGetter || !setter, isSSR); + if (debugOptions && !isSSR) { + cRef.effect.onTrack = debugOptions.onTrack; + cRef.effect.onTrigger = debugOptions.onTrigger; + } + return cRef; + } + + function trackRefValue(ref2) { + var _a; + if (shouldTrack && activeEffect) { + ref2 = toRaw(ref2); + trackEffect( + activeEffect, + (_a = ref2.dep) != null ? _a : ref2.dep = createDep( + () => ref2.dep = void 0, + ref2 instanceof ComputedRefImpl ? ref2 : void 0 + ), + { + target: ref2, + type: "get", + key: "value" + } + ); + } + } + function triggerRefValue(ref2, dirtyLevel = 5, newVal, oldVal) { + ref2 = toRaw(ref2); + const dep = ref2.dep; + if (dep) { + triggerEffects( + dep, + dirtyLevel, + { + target: ref2, + type: "set", + key: "value", + newValue: newVal, + oldValue: oldVal + } + ); + } + } + function isRef(r) { + return !!(r && r.__v_isRef === true); + } + function ref(value) { + return createRef(value, false); + } + function shallowRef(value) { + return createRef(value, true); + } + function createRef(rawValue, shallow) { + if (isRef(rawValue)) { + return rawValue; + } + return new RefImpl(rawValue, shallow); + } + class RefImpl { + constructor(value, __v_isShallow) { + this.__v_isShallow = __v_isShallow; + this.dep = void 0; + this.__v_isRef = true; + this._rawValue = __v_isShallow ? value : toRaw(value); + this._value = __v_isShallow ? value : toReactive(value); + } + get value() { + trackRefValue(this); + return this._value; + } + set value(newVal) { + const useDirectValue = this.__v_isShallow || isShallow(newVal) || isReadonly(newVal); + newVal = useDirectValue ? newVal : toRaw(newVal); + if (hasChanged(newVal, this._rawValue)) { + const oldVal = this._rawValue; + this._rawValue = newVal; + this._value = useDirectValue ? newVal : toReactive(newVal); + triggerRefValue(this, 5, newVal, oldVal); + } + } + } + function triggerRef(ref2) { + triggerRefValue(ref2, 5, ref2.value ); + } + function unref(ref2) { + return isRef(ref2) ? ref2.value : ref2; + } + function toValue(source) { + return isFunction(source) ? source() : unref(source); + } + const shallowUnwrapHandlers = { + get: (target, key, receiver) => unref(Reflect.get(target, key, receiver)), + set: (target, key, value, receiver) => { + const oldValue = target[key]; + if (isRef(oldValue) && !isRef(value)) { + oldValue.value = value; + return true; + } else { + return Reflect.set(target, key, value, receiver); + } + } + }; + function proxyRefs(objectWithRefs) { + return isReactive(objectWithRefs) ? objectWithRefs : new Proxy(objectWithRefs, shallowUnwrapHandlers); + } + class CustomRefImpl { + constructor(factory) { + this.dep = void 0; + this.__v_isRef = true; + const { get, set } = factory( + () => trackRefValue(this), + () => triggerRefValue(this) + ); + this._get = get; + this._set = set; + } + get value() { + return this._get(); + } + set value(newVal) { + this._set(newVal); + } + } + function customRef(factory) { + return new CustomRefImpl(factory); + } + function toRefs(object) { + if (!isProxy(object)) { + warn$2(`toRefs() expects a reactive object but received a plain one.`); + } + const ret = isArray(object) ? new Array(object.length) : {}; + for (const key in object) { + ret[key] = propertyToRef(object, key); + } + return ret; + } + class ObjectRefImpl { + constructor(_object, _key, _defaultValue) { + this._object = _object; + this._key = _key; + this._defaultValue = _defaultValue; + this.__v_isRef = true; + } + get value() { + const val = this._object[this._key]; + return val === void 0 ? this._defaultValue : val; + } + set value(newVal) { + this._object[this._key] = newVal; + } + get dep() { + return getDepFromReactive(toRaw(this._object), this._key); + } + } + class GetterRefImpl { + constructor(_getter) { + this._getter = _getter; + this.__v_isRef = true; + this.__v_isReadonly = true; + } + get value() { + return this._getter(); + } + } + function toRef(source, key, defaultValue) { + if (isRef(source)) { + return source; + } else if (isFunction(source)) { + return new GetterRefImpl(source); + } else if (isObject(source) && arguments.length > 1) { + return propertyToRef(source, key, defaultValue); + } else { + return ref(source); + } + } + function propertyToRef(source, key, defaultValue) { + const val = source[key]; + return isRef(val) ? val : new ObjectRefImpl(source, key, defaultValue); + } + + const TrackOpTypes = { + "GET": "get", + "HAS": "has", + "ITERATE": "iterate" + }; + const TriggerOpTypes = { + "SET": "set", + "ADD": "add", + "DELETE": "delete", + "CLEAR": "clear" + }; + + const stack$1 = []; + function pushWarningContext(vnode) { + stack$1.push(vnode); + } + function popWarningContext() { + stack$1.pop(); + } + function warn$1(msg, ...args) { + pauseTracking(); + const instance = stack$1.length ? stack$1[stack$1.length - 1].component : null; + const appWarnHandler = instance && instance.appContext.config.warnHandler; + const trace = getComponentTrace(); + if (appWarnHandler) { + callWithErrorHandling( + appWarnHandler, + instance, + 11, + [ + // eslint-disable-next-line no-restricted-syntax + msg + args.map((a) => { + var _a, _b; + return (_b = (_a = a.toString) == null ? void 0 : _a.call(a)) != null ? _b : JSON.stringify(a); + }).join(""), + instance && instance.proxy, + trace.map( + ({ vnode }) => `at <${formatComponentName(instance, vnode.type)}>` + ).join("\n"), + trace + ] + ); + } else { + const warnArgs = [`[Vue warn]: ${msg}`, ...args]; + if (trace.length && // avoid spamming console during tests + true) { + warnArgs.push(` +`, ...formatTrace(trace)); + } + console.warn(...warnArgs); + } + resetTracking(); + } + function getComponentTrace() { + let currentVNode = stack$1[stack$1.length - 1]; + if (!currentVNode) { + return []; + } + const normalizedStack = []; + while (currentVNode) { + const last = normalizedStack[0]; + if (last && last.vnode === currentVNode) { + last.recurseCount++; + } else { + normalizedStack.push({ + vnode: currentVNode, + recurseCount: 0 + }); + } + const parentInstance = currentVNode.component && currentVNode.component.parent; + currentVNode = parentInstance && parentInstance.vnode; + } + return normalizedStack; + } + function formatTrace(trace) { + const logs = []; + trace.forEach((entry, i) => { + logs.push(...i === 0 ? [] : [` +`], ...formatTraceEntry(entry)); + }); + return logs; + } + function formatTraceEntry({ vnode, recurseCount }) { + const postfix = recurseCount > 0 ? `... (${recurseCount} recursive calls)` : ``; + const isRoot = vnode.component ? vnode.component.parent == null : false; + const open = ` at <${formatComponentName( + vnode.component, + vnode.type, + isRoot + )}`; + const close = `>` + postfix; + return vnode.props ? [open, ...formatProps(vnode.props), close] : [open + close]; + } + function formatProps(props) { + const res = []; + const keys = Object.keys(props); + keys.slice(0, 3).forEach((key) => { + res.push(...formatProp(key, props[key])); + }); + if (keys.length > 3) { + res.push(` ...`); + } + return res; + } + function formatProp(key, value, raw) { + if (isString(value)) { + value = JSON.stringify(value); + return raw ? value : [`${key}=${value}`]; + } else if (typeof value === "number" || typeof value === "boolean" || value == null) { + return raw ? value : [`${key}=${value}`]; + } else if (isRef(value)) { + value = formatProp(key, toRaw(value.value), true); + return raw ? value : [`${key}=Ref<`, value, `>`]; + } else if (isFunction(value)) { + return [`${key}=fn${value.name ? `<${value.name}>` : ``}`]; + } else { + value = toRaw(value); + return raw ? value : [`${key}=`, value]; + } + } + function assertNumber(val, type) { + if (val === void 0) { + return; + } else if (typeof val !== "number") { + warn$1(`${type} is not a valid number - got ${JSON.stringify(val)}.`); + } else if (isNaN(val)) { + warn$1(`${type} is NaN - the duration expression might be incorrect.`); + } + } + + const ErrorCodes = { + "SETUP_FUNCTION": 0, + "0": "SETUP_FUNCTION", + "RENDER_FUNCTION": 1, + "1": "RENDER_FUNCTION", + "WATCH_GETTER": 2, + "2": "WATCH_GETTER", + "WATCH_CALLBACK": 3, + "3": "WATCH_CALLBACK", + "WATCH_CLEANUP": 4, + "4": "WATCH_CLEANUP", + "NATIVE_EVENT_HANDLER": 5, + "5": "NATIVE_EVENT_HANDLER", + "COMPONENT_EVENT_HANDLER": 6, + "6": "COMPONENT_EVENT_HANDLER", + "VNODE_HOOK": 7, + "7": "VNODE_HOOK", + "DIRECTIVE_HOOK": 8, + "8": "DIRECTIVE_HOOK", + "TRANSITION_HOOK": 9, + "9": "TRANSITION_HOOK", + "APP_ERROR_HANDLER": 10, + "10": "APP_ERROR_HANDLER", + "APP_WARN_HANDLER": 11, + "11": "APP_WARN_HANDLER", + "FUNCTION_REF": 12, + "12": "FUNCTION_REF", + "ASYNC_COMPONENT_LOADER": 13, + "13": "ASYNC_COMPONENT_LOADER", + "SCHEDULER": 14, + "14": "SCHEDULER" + }; + const ErrorTypeStrings$1 = { + ["sp"]: "serverPrefetch hook", + ["bc"]: "beforeCreate hook", + ["c"]: "created hook", + ["bm"]: "beforeMount hook", + ["m"]: "mounted hook", + ["bu"]: "beforeUpdate hook", + ["u"]: "updated", + ["bum"]: "beforeUnmount hook", + ["um"]: "unmounted hook", + ["a"]: "activated hook", + ["da"]: "deactivated hook", + ["ec"]: "errorCaptured hook", + ["rtc"]: "renderTracked hook", + ["rtg"]: "renderTriggered hook", + [0]: "setup function", + [1]: "render function", + [2]: "watcher getter", + [3]: "watcher callback", + [4]: "watcher cleanup function", + [5]: "native event handler", + [6]: "component event handler", + [7]: "vnode hook", + [8]: "directive hook", + [9]: "transition hook", + [10]: "app errorHandler", + [11]: "app warnHandler", + [12]: "ref function", + [13]: "async component loader", + [14]: "scheduler flush. This is likely a Vue internals bug. Please open an issue at https://github.com/vuejs/core ." + }; + function callWithErrorHandling(fn, instance, type, args) { + try { + return args ? fn(...args) : fn(); + } catch (err) { + handleError(err, instance, type); + } + } + function callWithAsyncErrorHandling(fn, instance, type, args) { + if (isFunction(fn)) { + const res = callWithErrorHandling(fn, instance, type, args); + if (res && isPromise(res)) { + res.catch((err) => { + handleError(err, instance, type); + }); + } + return res; + } + if (isArray(fn)) { + const values = []; + for (let i = 0; i < fn.length; i++) { + values.push(callWithAsyncErrorHandling(fn[i], instance, type, args)); + } + return values; + } else { + warn$1( + `Invalid value type passed to callWithAsyncErrorHandling(): ${typeof fn}` + ); + } + } + function handleError(err, instance, type, throwInDev = true) { + const contextVNode = instance ? instance.vnode : null; + if (instance) { + let cur = instance.parent; + const exposedInstance = instance.proxy; + const errorInfo = ErrorTypeStrings$1[type] ; + while (cur) { + const errorCapturedHooks = cur.ec; + if (errorCapturedHooks) { + for (let i = 0; i < errorCapturedHooks.length; i++) { + if (errorCapturedHooks[i](err, exposedInstance, errorInfo) === false) { + return; + } + } + } + cur = cur.parent; + } + const appErrorHandler = instance.appContext.config.errorHandler; + if (appErrorHandler) { + pauseTracking(); + callWithErrorHandling( + appErrorHandler, + null, + 10, + [err, exposedInstance, errorInfo] + ); + resetTracking(); + return; + } + } + logError(err, type, contextVNode, throwInDev); + } + function logError(err, type, contextVNode, throwInDev = true) { + { + const info = ErrorTypeStrings$1[type]; + if (contextVNode) { + pushWarningContext(contextVNode); + } + warn$1(`Unhandled error${info ? ` during execution of ${info}` : ``}`); + if (contextVNode) { + popWarningContext(); + } + if (throwInDev) { + throw err; + } else { + console.error(err); + } + } + } + + let isFlushing = false; + let isFlushPending = false; + const queue = []; + let flushIndex = 0; + const pendingPostFlushCbs = []; + let activePostFlushCbs = null; + let postFlushIndex = 0; + const resolvedPromise = /* @__PURE__ */ Promise.resolve(); + let currentFlushPromise = null; + const RECURSION_LIMIT = 100; + function nextTick(fn) { + const p = currentFlushPromise || resolvedPromise; + return fn ? p.then(this ? fn.bind(this) : fn) : p; + } + function findInsertionIndex(id) { + let start = flushIndex + 1; + let end = queue.length; + while (start < end) { + const middle = start + end >>> 1; + const middleJob = queue[middle]; + const middleJobId = getId(middleJob); + if (middleJobId < id || middleJobId === id && middleJob.pre) { + start = middle + 1; + } else { + end = middle; + } + } + return start; + } + function queueJob(job) { + if (!queue.length || !queue.includes( + job, + isFlushing && job.allowRecurse ? flushIndex + 1 : flushIndex + )) { + if (job.id == null) { + queue.push(job); + } else { + queue.splice(findInsertionIndex(job.id), 0, job); + } + queueFlush(); + } + } + function queueFlush() { + if (!isFlushing && !isFlushPending) { + isFlushPending = true; + currentFlushPromise = resolvedPromise.then(flushJobs); + } + } + function invalidateJob(job) { + const i = queue.indexOf(job); + if (i > flushIndex) { + queue.splice(i, 1); + } + } + function queuePostFlushCb(cb) { + if (!isArray(cb)) { + if (!activePostFlushCbs || !activePostFlushCbs.includes( + cb, + cb.allowRecurse ? postFlushIndex + 1 : postFlushIndex + )) { + pendingPostFlushCbs.push(cb); + } + } else { + pendingPostFlushCbs.push(...cb); + } + queueFlush(); + } + function flushPreFlushCbs(instance, seen, i = isFlushing ? flushIndex + 1 : 0) { + { + seen = seen || /* @__PURE__ */ new Map(); + } + for (; i < queue.length; i++) { + const cb = queue[i]; + if (cb && cb.pre) { + if (instance && cb.id !== instance.uid) { + continue; + } + if (checkRecursiveUpdates(seen, cb)) { + continue; + } + queue.splice(i, 1); + i--; + cb(); + } + } + } + function flushPostFlushCbs(seen) { + if (pendingPostFlushCbs.length) { + const deduped = [...new Set(pendingPostFlushCbs)].sort( + (a, b) => getId(a) - getId(b) + ); + pendingPostFlushCbs.length = 0; + if (activePostFlushCbs) { + activePostFlushCbs.push(...deduped); + return; + } + activePostFlushCbs = deduped; + { + seen = seen || /* @__PURE__ */ new Map(); + } + for (postFlushIndex = 0; postFlushIndex < activePostFlushCbs.length; postFlushIndex++) { + const cb = activePostFlushCbs[postFlushIndex]; + if (checkRecursiveUpdates(seen, cb)) { + continue; + } + if (cb.active !== false) cb(); + } + activePostFlushCbs = null; + postFlushIndex = 0; + } + } + const getId = (job) => job.id == null ? Infinity : job.id; + const comparator = (a, b) => { + const diff = getId(a) - getId(b); + if (diff === 0) { + if (a.pre && !b.pre) return -1; + if (b.pre && !a.pre) return 1; + } + return diff; + }; + function flushJobs(seen) { + isFlushPending = false; + isFlushing = true; + { + seen = seen || /* @__PURE__ */ new Map(); + } + queue.sort(comparator); + const check = (job) => checkRecursiveUpdates(seen, job) ; + try { + for (flushIndex = 0; flushIndex < queue.length; flushIndex++) { + const job = queue[flushIndex]; + if (job && job.active !== false) { + if (check(job)) { + continue; + } + callWithErrorHandling(job, null, 14); + } + } + } finally { + flushIndex = 0; + queue.length = 0; + flushPostFlushCbs(seen); + isFlushing = false; + currentFlushPromise = null; + if (queue.length || pendingPostFlushCbs.length) { + flushJobs(seen); + } + } + } + function checkRecursiveUpdates(seen, fn) { + if (!seen.has(fn)) { + seen.set(fn, 1); + } else { + const count = seen.get(fn); + if (count > RECURSION_LIMIT) { + const instance = fn.ownerInstance; + const componentName = instance && getComponentName(instance.type); + handleError( + `Maximum recursive updates exceeded${componentName ? ` in component <${componentName}>` : ``}. This means you have a reactive effect that is mutating its own dependencies and thus recursively triggering itself. Possible sources include component template, render function, updated hook or watcher source function.`, + null, + 10 + ); + return true; + } else { + seen.set(fn, count + 1); + } + } + } + + let isHmrUpdating = false; + const hmrDirtyComponents = /* @__PURE__ */ new Set(); + { + getGlobalThis().__VUE_HMR_RUNTIME__ = { + createRecord: tryWrap(createRecord), + rerender: tryWrap(rerender), + reload: tryWrap(reload) + }; + } + const map = /* @__PURE__ */ new Map(); + function registerHMR(instance) { + const id = instance.type.__hmrId; + let record = map.get(id); + if (!record) { + createRecord(id, instance.type); + record = map.get(id); + } + record.instances.add(instance); + } + function unregisterHMR(instance) { + map.get(instance.type.__hmrId).instances.delete(instance); + } + function createRecord(id, initialDef) { + if (map.has(id)) { + return false; + } + map.set(id, { + initialDef: normalizeClassComponent(initialDef), + instances: /* @__PURE__ */ new Set() + }); + return true; + } + function normalizeClassComponent(component) { + return isClassComponent(component) ? component.__vccOpts : component; + } + function rerender(id, newRender) { + const record = map.get(id); + if (!record) { + return; + } + record.initialDef.render = newRender; + [...record.instances].forEach((instance) => { + if (newRender) { + instance.render = newRender; + normalizeClassComponent(instance.type).render = newRender; + } + instance.renderCache = []; + isHmrUpdating = true; + instance.effect.dirty = true; + instance.update(); + isHmrUpdating = false; + }); + } + function reload(id, newComp) { + const record = map.get(id); + if (!record) return; + newComp = normalizeClassComponent(newComp); + updateComponentDef(record.initialDef, newComp); + const instances = [...record.instances]; + for (const instance of instances) { + const oldComp = normalizeClassComponent(instance.type); + if (!hmrDirtyComponents.has(oldComp)) { + if (oldComp !== record.initialDef) { + updateComponentDef(oldComp, newComp); + } + hmrDirtyComponents.add(oldComp); + } + instance.appContext.propsCache.delete(instance.type); + instance.appContext.emitsCache.delete(instance.type); + instance.appContext.optionsCache.delete(instance.type); + if (instance.ceReload) { + hmrDirtyComponents.add(oldComp); + instance.ceReload(newComp.styles); + hmrDirtyComponents.delete(oldComp); + } else if (instance.parent) { + instance.parent.effect.dirty = true; + queueJob(() => { + instance.parent.update(); + hmrDirtyComponents.delete(oldComp); + }); + } else if (instance.appContext.reload) { + instance.appContext.reload(); + } else if (typeof window !== "undefined") { + window.location.reload(); + } else { + console.warn( + "[HMR] Root or manually mounted instance modified. Full reload required." + ); + } + } + queuePostFlushCb(() => { + for (const instance of instances) { + hmrDirtyComponents.delete( + normalizeClassComponent(instance.type) + ); + } + }); + } + function updateComponentDef(oldComp, newComp) { + extend(oldComp, newComp); + for (const key in oldComp) { + if (key !== "__file" && !(key in newComp)) { + delete oldComp[key]; + } + } + } + function tryWrap(fn) { + return (id, arg) => { + try { + return fn(id, arg); + } catch (e) { + console.error(e); + console.warn( + `[HMR] Something went wrong during Vue component hot-reload. Full reload required.` + ); + } + }; + } + + let devtools$1; + let buffer = []; + let devtoolsNotInstalled = false; + function emit$1(event, ...args) { + if (devtools$1) { + devtools$1.emit(event, ...args); + } else if (!devtoolsNotInstalled) { + buffer.push({ event, args }); + } + } + function setDevtoolsHook$1(hook, target) { + var _a, _b; + devtools$1 = hook; + if (devtools$1) { + devtools$1.enabled = true; + buffer.forEach(({ event, args }) => devtools$1.emit(event, ...args)); + buffer = []; + } else if ( + // handle late devtools injection - only do this if we are in an actual + // browser environment to avoid the timer handle stalling test runner exit + // (#4815) + typeof window !== "undefined" && // some envs mock window but not fully + window.HTMLElement && // also exclude jsdom + // eslint-disable-next-line no-restricted-syntax + !((_b = (_a = window.navigator) == null ? void 0 : _a.userAgent) == null ? void 0 : _b.includes("jsdom")) + ) { + const replay = target.__VUE_DEVTOOLS_HOOK_REPLAY__ = target.__VUE_DEVTOOLS_HOOK_REPLAY__ || []; + replay.push((newHook) => { + setDevtoolsHook$1(newHook, target); + }); + setTimeout(() => { + if (!devtools$1) { + target.__VUE_DEVTOOLS_HOOK_REPLAY__ = null; + devtoolsNotInstalled = true; + buffer = []; + } + }, 3e3); + } else { + devtoolsNotInstalled = true; + buffer = []; + } + } + function devtoolsInitApp(app, version) { + emit$1("app:init" /* APP_INIT */, app, version, { + Fragment, + Text, + Comment, + Static + }); + } + function devtoolsUnmountApp(app) { + emit$1("app:unmount" /* APP_UNMOUNT */, app); + } + const devtoolsComponentAdded = /* @__PURE__ */ createDevtoolsComponentHook( + "component:added" /* COMPONENT_ADDED */ + ); + const devtoolsComponentUpdated = /* @__PURE__ */ createDevtoolsComponentHook("component:updated" /* COMPONENT_UPDATED */); + const _devtoolsComponentRemoved = /* @__PURE__ */ createDevtoolsComponentHook( + "component:removed" /* COMPONENT_REMOVED */ + ); + const devtoolsComponentRemoved = (component) => { + if (devtools$1 && typeof devtools$1.cleanupBuffer === "function" && // remove the component if it wasn't buffered + !devtools$1.cleanupBuffer(component)) { + _devtoolsComponentRemoved(component); + } + }; + /*! #__NO_SIDE_EFFECTS__ */ + // @__NO_SIDE_EFFECTS__ + function createDevtoolsComponentHook(hook) { + return (component) => { + emit$1( + hook, + component.appContext.app, + component.uid, + component.parent ? component.parent.uid : void 0, + component + ); + }; + } + const devtoolsPerfStart = /* @__PURE__ */ createDevtoolsPerformanceHook( + "perf:start" /* PERFORMANCE_START */ + ); + const devtoolsPerfEnd = /* @__PURE__ */ createDevtoolsPerformanceHook( + "perf:end" /* PERFORMANCE_END */ + ); + function createDevtoolsPerformanceHook(hook) { + return (component, type, time) => { + emit$1(hook, component.appContext.app, component.uid, component, type, time); + }; + } + function devtoolsComponentEmit(component, event, params) { + emit$1( + "component:emit" /* COMPONENT_EMIT */, + component.appContext.app, + component, + event, + params + ); + } + + function emit(instance, event, ...rawArgs) { + if (instance.isUnmounted) return; + const props = instance.vnode.props || EMPTY_OBJ; + { + const { + emitsOptions, + propsOptions: [propsOptions] + } = instance; + if (emitsOptions) { + if (!(event in emitsOptions) && true) { + if (!propsOptions || !(toHandlerKey(event) in propsOptions)) { + warn$1( + `Component emitted event "${event}" but it is neither declared in the emits option nor as an "${toHandlerKey(event)}" prop.` + ); + } + } else { + const validator = emitsOptions[event]; + if (isFunction(validator)) { + const isValid = validator(...rawArgs); + if (!isValid) { + warn$1( + `Invalid event arguments: event validation failed for event "${event}".` + ); + } + } + } + } + } + let args = rawArgs; + const isModelListener = event.startsWith("update:"); + const modelArg = isModelListener && event.slice(7); + if (modelArg && modelArg in props) { + const modifiersKey = `${modelArg === "modelValue" ? "model" : modelArg}Modifiers`; + const { number, trim } = props[modifiersKey] || EMPTY_OBJ; + if (trim) { + args = rawArgs.map((a) => isString(a) ? a.trim() : a); + } + if (number) { + args = rawArgs.map(looseToNumber); + } + } + { + devtoolsComponentEmit(instance, event, args); + } + { + const lowerCaseEvent = event.toLowerCase(); + if (lowerCaseEvent !== event && props[toHandlerKey(lowerCaseEvent)]) { + warn$1( + `Event "${lowerCaseEvent}" is emitted in component ${formatComponentName( + instance, + instance.type + )} but the handler is registered for "${event}". Note that HTML attributes are case-insensitive and you cannot use v-on to listen to camelCase events when using in-DOM templates. You should probably use "${hyphenate( + event + )}" instead of "${event}".` + ); + } + } + let handlerName; + let handler = props[handlerName = toHandlerKey(event)] || // also try camelCase event handler (#2249) + props[handlerName = toHandlerKey(camelize(event))]; + if (!handler && isModelListener) { + handler = props[handlerName = toHandlerKey(hyphenate(event))]; + } + if (handler) { + callWithAsyncErrorHandling( + handler, + instance, + 6, + args + ); + } + const onceHandler = props[handlerName + `Once`]; + if (onceHandler) { + if (!instance.emitted) { + instance.emitted = {}; + } else if (instance.emitted[handlerName]) { + return; + } + instance.emitted[handlerName] = true; + callWithAsyncErrorHandling( + onceHandler, + instance, + 6, + args + ); + } + } + function normalizeEmitsOptions(comp, appContext, asMixin = false) { + const cache = appContext.emitsCache; + const cached = cache.get(comp); + if (cached !== void 0) { + return cached; + } + const raw = comp.emits; + let normalized = {}; + let hasExtends = false; + if (!isFunction(comp)) { + const extendEmits = (raw2) => { + const normalizedFromExtend = normalizeEmitsOptions(raw2, appContext, true); + if (normalizedFromExtend) { + hasExtends = true; + extend(normalized, normalizedFromExtend); + } + }; + if (!asMixin && appContext.mixins.length) { + appContext.mixins.forEach(extendEmits); + } + if (comp.extends) { + extendEmits(comp.extends); + } + if (comp.mixins) { + comp.mixins.forEach(extendEmits); + } + } + if (!raw && !hasExtends) { + if (isObject(comp)) { + cache.set(comp, null); + } + return null; + } + if (isArray(raw)) { + raw.forEach((key) => normalized[key] = null); + } else { + extend(normalized, raw); + } + if (isObject(comp)) { + cache.set(comp, normalized); + } + return normalized; + } + function isEmitListener(options, key) { + if (!options || !isOn(key)) { + return false; + } + key = key.slice(2).replace(/Once$/, ""); + return hasOwn(options, key[0].toLowerCase() + key.slice(1)) || hasOwn(options, hyphenate(key)) || hasOwn(options, key); + } + + let currentRenderingInstance = null; + let currentScopeId = null; + function setCurrentRenderingInstance(instance) { + const prev = currentRenderingInstance; + currentRenderingInstance = instance; + currentScopeId = instance && instance.type.__scopeId || null; + return prev; + } + function pushScopeId(id) { + currentScopeId = id; + } + function popScopeId() { + currentScopeId = null; + } + const withScopeId = (_id) => withCtx; + function withCtx(fn, ctx = currentRenderingInstance, isNonScopedSlot) { + if (!ctx) return fn; + if (fn._n) { + return fn; + } + const renderFnWithContext = (...args) => { + if (renderFnWithContext._d) { + setBlockTracking(-1); + } + const prevInstance = setCurrentRenderingInstance(ctx); + let res; + try { + res = fn(...args); + } finally { + setCurrentRenderingInstance(prevInstance); + if (renderFnWithContext._d) { + setBlockTracking(1); + } + } + { + devtoolsComponentUpdated(ctx); + } + return res; + }; + renderFnWithContext._n = true; + renderFnWithContext._c = true; + renderFnWithContext._d = true; + return renderFnWithContext; + } + + let accessedAttrs = false; + function markAttrsAccessed() { + accessedAttrs = true; + } + function renderComponentRoot(instance) { + const { + type: Component, + vnode, + proxy, + withProxy, + propsOptions: [propsOptions], + slots, + attrs, + emit, + render, + renderCache, + props, + data, + setupState, + ctx, + inheritAttrs + } = instance; + const prev = setCurrentRenderingInstance(instance); + let result; + let fallthroughAttrs; + { + accessedAttrs = false; + } + try { + if (vnode.shapeFlag & 4) { + const proxyToUse = withProxy || proxy; + const thisProxy = setupState.__isScriptSetup ? new Proxy(proxyToUse, { + get(target, key, receiver) { + warn$1( + `Property '${String( + key + )}' was accessed via 'this'. Avoid using 'this' in templates.` + ); + return Reflect.get(target, key, receiver); + } + }) : proxyToUse; + result = normalizeVNode( + render.call( + thisProxy, + proxyToUse, + renderCache, + true ? shallowReadonly(props) : props, + setupState, + data, + ctx + ) + ); + fallthroughAttrs = attrs; + } else { + const render2 = Component; + if (attrs === props) { + markAttrsAccessed(); + } + result = normalizeVNode( + render2.length > 1 ? render2( + true ? shallowReadonly(props) : props, + true ? { + get attrs() { + markAttrsAccessed(); + return shallowReadonly(attrs); + }, + slots, + emit + } : { attrs, slots, emit } + ) : render2( + true ? shallowReadonly(props) : props, + null + ) + ); + fallthroughAttrs = Component.props ? attrs : getFunctionalFallthrough(attrs); + } + } catch (err) { + blockStack.length = 0; + handleError(err, instance, 1); + result = createVNode(Comment); + } + let root = result; + let setRoot = void 0; + if (result.patchFlag > 0 && result.patchFlag & 2048) { + [root, setRoot] = getChildRoot(result); + } + if (fallthroughAttrs && inheritAttrs !== false) { + const keys = Object.keys(fallthroughAttrs); + const { shapeFlag } = root; + if (keys.length) { + if (shapeFlag & (1 | 6)) { + if (propsOptions && keys.some(isModelListener)) { + fallthroughAttrs = filterModelListeners( + fallthroughAttrs, + propsOptions + ); + } + root = cloneVNode(root, fallthroughAttrs, false, true); + } else if (!accessedAttrs && root.type !== Comment) { + const allAttrs = Object.keys(attrs); + const eventAttrs = []; + const extraAttrs = []; + for (let i = 0, l = allAttrs.length; i < l; i++) { + const key = allAttrs[i]; + if (isOn(key)) { + if (!isModelListener(key)) { + eventAttrs.push(key[2].toLowerCase() + key.slice(3)); + } + } else { + extraAttrs.push(key); + } + } + if (extraAttrs.length) { + warn$1( + `Extraneous non-props attributes (${extraAttrs.join(", ")}) were passed to component but could not be automatically inherited because component renders fragment or text root nodes.` + ); + } + if (eventAttrs.length) { + warn$1( + `Extraneous non-emits event listeners (${eventAttrs.join(", ")}) were passed to component but could not be automatically inherited because component renders fragment or text root nodes. If the listener is intended to be a component custom event listener only, declare it using the "emits" option.` + ); + } + } + } + } + if (vnode.dirs) { + if (!isElementRoot(root)) { + warn$1( + `Runtime directive used on component with non-element root node. The directives will not function as intended.` + ); + } + root = cloneVNode(root, null, false, true); + root.dirs = root.dirs ? root.dirs.concat(vnode.dirs) : vnode.dirs; + } + if (vnode.transition) { + if (!isElementRoot(root)) { + warn$1( + `Component inside renders non-element root node that cannot be animated.` + ); + } + root.transition = vnode.transition; + } + if (setRoot) { + setRoot(root); + } else { + result = root; + } + setCurrentRenderingInstance(prev); + return result; + } + const getChildRoot = (vnode) => { + const rawChildren = vnode.children; + const dynamicChildren = vnode.dynamicChildren; + const childRoot = filterSingleRoot(rawChildren, false); + if (!childRoot) { + return [vnode, void 0]; + } else if (childRoot.patchFlag > 0 && childRoot.patchFlag & 2048) { + return getChildRoot(childRoot); + } + const index = rawChildren.indexOf(childRoot); + const dynamicIndex = dynamicChildren ? dynamicChildren.indexOf(childRoot) : -1; + const setRoot = (updatedRoot) => { + rawChildren[index] = updatedRoot; + if (dynamicChildren) { + if (dynamicIndex > -1) { + dynamicChildren[dynamicIndex] = updatedRoot; + } else if (updatedRoot.patchFlag > 0) { + vnode.dynamicChildren = [...dynamicChildren, updatedRoot]; + } + } + }; + return [normalizeVNode(childRoot), setRoot]; + }; + function filterSingleRoot(children, recurse = true) { + let singleRoot; + for (let i = 0; i < children.length; i++) { + const child = children[i]; + if (isVNode(child)) { + if (child.type !== Comment || child.children === "v-if") { + if (singleRoot) { + return; + } else { + singleRoot = child; + if (recurse && singleRoot.patchFlag > 0 && singleRoot.patchFlag & 2048) { + return filterSingleRoot(singleRoot.children); + } + } + } + } else { + return; + } + } + return singleRoot; + } + const getFunctionalFallthrough = (attrs) => { + let res; + for (const key in attrs) { + if (key === "class" || key === "style" || isOn(key)) { + (res || (res = {}))[key] = attrs[key]; + } + } + return res; + }; + const filterModelListeners = (attrs, props) => { + const res = {}; + for (const key in attrs) { + if (!isModelListener(key) || !(key.slice(9) in props)) { + res[key] = attrs[key]; + } + } + return res; + }; + const isElementRoot = (vnode) => { + return vnode.shapeFlag & (6 | 1) || vnode.type === Comment; + }; + function shouldUpdateComponent(prevVNode, nextVNode, optimized) { + const { props: prevProps, children: prevChildren, component } = prevVNode; + const { props: nextProps, children: nextChildren, patchFlag } = nextVNode; + const emits = component.emitsOptions; + if ((prevChildren || nextChildren) && isHmrUpdating) { + return true; + } + if (nextVNode.dirs || nextVNode.transition) { + return true; + } + if (optimized && patchFlag >= 0) { + if (patchFlag & 1024) { + return true; + } + if (patchFlag & 16) { + if (!prevProps) { + return !!nextProps; + } + return hasPropsChanged(prevProps, nextProps, emits); + } else if (patchFlag & 8) { + const dynamicProps = nextVNode.dynamicProps; + for (let i = 0; i < dynamicProps.length; i++) { + const key = dynamicProps[i]; + if (nextProps[key] !== prevProps[key] && !isEmitListener(emits, key)) { + return true; + } + } + } + } else { + if (prevChildren || nextChildren) { + if (!nextChildren || !nextChildren.$stable) { + return true; + } + } + if (prevProps === nextProps) { + return false; + } + if (!prevProps) { + return !!nextProps; + } + if (!nextProps) { + return true; + } + return hasPropsChanged(prevProps, nextProps, emits); + } + return false; + } + function hasPropsChanged(prevProps, nextProps, emitsOptions) { + const nextKeys = Object.keys(nextProps); + if (nextKeys.length !== Object.keys(prevProps).length) { + return true; + } + for (let i = 0; i < nextKeys.length; i++) { + const key = nextKeys[i]; + if (nextProps[key] !== prevProps[key] && !isEmitListener(emitsOptions, key)) { + return true; + } + } + return false; + } + function updateHOCHostEl({ vnode, parent }, el) { + while (parent) { + const root = parent.subTree; + if (root.suspense && root.suspense.activeBranch === vnode) { + root.el = vnode.el; + } + if (root === vnode) { + (vnode = parent.vnode).el = el; + parent = parent.parent; + } else { + break; + } + } + } + + const COMPONENTS = "components"; + const DIRECTIVES = "directives"; + function resolveComponent(name, maybeSelfReference) { + return resolveAsset(COMPONENTS, name, true, maybeSelfReference) || name; + } + const NULL_DYNAMIC_COMPONENT = Symbol.for("v-ndc"); + function resolveDynamicComponent(component) { + if (isString(component)) { + return resolveAsset(COMPONENTS, component, false) || component; + } else { + return component || NULL_DYNAMIC_COMPONENT; + } + } + function resolveDirective(name) { + return resolveAsset(DIRECTIVES, name); + } + function resolveAsset(type, name, warnMissing = true, maybeSelfReference = false) { + const instance = currentRenderingInstance || currentInstance; + if (instance) { + const Component = instance.type; + if (type === COMPONENTS) { + const selfName = getComponentName( + Component, + false + ); + if (selfName && (selfName === name || selfName === camelize(name) || selfName === capitalize(camelize(name)))) { + return Component; + } + } + const res = ( + // local registration + // check instance[type] first which is resolved for options API + resolve(instance[type] || Component[type], name) || // global registration + resolve(instance.appContext[type], name) + ); + if (!res && maybeSelfReference) { + return Component; + } + if (warnMissing && !res) { + const extra = type === COMPONENTS ? ` +If this is a native custom element, make sure to exclude it from component resolution via compilerOptions.isCustomElement.` : ``; + warn$1(`Failed to resolve ${type.slice(0, -1)}: ${name}${extra}`); + } + return res; + } else { + warn$1( + `resolve${capitalize(type.slice(0, -1))} can only be used in render() or setup().` + ); + } + } + function resolve(registry, name) { + return registry && (registry[name] || registry[camelize(name)] || registry[capitalize(camelize(name))]); + } + + const isSuspense = (type) => type.__isSuspense; + let suspenseId = 0; + const SuspenseImpl = { + name: "Suspense", + // In order to make Suspense tree-shakable, we need to avoid importing it + // directly in the renderer. The renderer checks for the __isSuspense flag + // on a vnode's type and calls the `process` method, passing in renderer + // internals. + __isSuspense: true, + process(n1, n2, container, anchor, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals) { + if (n1 == null) { + mountSuspense( + n2, + container, + anchor, + parentComponent, + parentSuspense, + namespace, + slotScopeIds, + optimized, + rendererInternals + ); + } else { + if (parentSuspense && parentSuspense.deps > 0 && !n1.suspense.isInFallback) { + n2.suspense = n1.suspense; + n2.suspense.vnode = n2; + n2.el = n1.el; + return; + } + patchSuspense( + n1, + n2, + container, + anchor, + parentComponent, + namespace, + slotScopeIds, + optimized, + rendererInternals + ); + } + }, + hydrate: hydrateSuspense, + create: createSuspenseBoundary, + normalize: normalizeSuspenseChildren + }; + const Suspense = SuspenseImpl ; + function triggerEvent(vnode, name) { + const eventListener = vnode.props && vnode.props[name]; + if (isFunction(eventListener)) { + eventListener(); + } + } + function mountSuspense(vnode, container, anchor, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals) { + const { + p: patch, + o: { createElement } + } = rendererInternals; + const hiddenContainer = createElement("div"); + const suspense = vnode.suspense = createSuspenseBoundary( + vnode, + parentSuspense, + parentComponent, + container, + hiddenContainer, + anchor, + namespace, + slotScopeIds, + optimized, + rendererInternals + ); + patch( + null, + suspense.pendingBranch = vnode.ssContent, + hiddenContainer, + null, + parentComponent, + suspense, + namespace, + slotScopeIds + ); + if (suspense.deps > 0) { + triggerEvent(vnode, "onPending"); + triggerEvent(vnode, "onFallback"); + patch( + null, + vnode.ssFallback, + container, + anchor, + parentComponent, + null, + // fallback tree will not have suspense context + namespace, + slotScopeIds + ); + setActiveBranch(suspense, vnode.ssFallback); + } else { + suspense.resolve(false, true); + } + } + function patchSuspense(n1, n2, container, anchor, parentComponent, namespace, slotScopeIds, optimized, { p: patch, um: unmount, o: { createElement } }) { + const suspense = n2.suspense = n1.suspense; + suspense.vnode = n2; + n2.el = n1.el; + const newBranch = n2.ssContent; + const newFallback = n2.ssFallback; + const { activeBranch, pendingBranch, isInFallback, isHydrating } = suspense; + if (pendingBranch) { + suspense.pendingBranch = newBranch; + if (isSameVNodeType(newBranch, pendingBranch)) { + patch( + pendingBranch, + newBranch, + suspense.hiddenContainer, + null, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + if (suspense.deps <= 0) { + suspense.resolve(); + } else if (isInFallback) { + if (!isHydrating) { + patch( + activeBranch, + newFallback, + container, + anchor, + parentComponent, + null, + // fallback tree will not have suspense context + namespace, + slotScopeIds, + optimized + ); + setActiveBranch(suspense, newFallback); + } + } + } else { + suspense.pendingId = suspenseId++; + if (isHydrating) { + suspense.isHydrating = false; + suspense.activeBranch = pendingBranch; + } else { + unmount(pendingBranch, parentComponent, suspense); + } + suspense.deps = 0; + suspense.effects.length = 0; + suspense.hiddenContainer = createElement("div"); + if (isInFallback) { + patch( + null, + newBranch, + suspense.hiddenContainer, + null, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + if (suspense.deps <= 0) { + suspense.resolve(); + } else { + patch( + activeBranch, + newFallback, + container, + anchor, + parentComponent, + null, + // fallback tree will not have suspense context + namespace, + slotScopeIds, + optimized + ); + setActiveBranch(suspense, newFallback); + } + } else if (activeBranch && isSameVNodeType(newBranch, activeBranch)) { + patch( + activeBranch, + newBranch, + container, + anchor, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + suspense.resolve(true); + } else { + patch( + null, + newBranch, + suspense.hiddenContainer, + null, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + if (suspense.deps <= 0) { + suspense.resolve(); + } + } + } + } else { + if (activeBranch && isSameVNodeType(newBranch, activeBranch)) { + patch( + activeBranch, + newBranch, + container, + anchor, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + setActiveBranch(suspense, newBranch); + } else { + triggerEvent(n2, "onPending"); + suspense.pendingBranch = newBranch; + if (newBranch.shapeFlag & 512) { + suspense.pendingId = newBranch.component.suspenseId; + } else { + suspense.pendingId = suspenseId++; + } + patch( + null, + newBranch, + suspense.hiddenContainer, + null, + parentComponent, + suspense, + namespace, + slotScopeIds, + optimized + ); + if (suspense.deps <= 0) { + suspense.resolve(); + } else { + const { timeout, pendingId } = suspense; + if (timeout > 0) { + setTimeout(() => { + if (suspense.pendingId === pendingId) { + suspense.fallback(newFallback); + } + }, timeout); + } else if (timeout === 0) { + suspense.fallback(newFallback); + } + } + } + } + } + let hasWarned = false; + function createSuspenseBoundary(vnode, parentSuspense, parentComponent, container, hiddenContainer, anchor, namespace, slotScopeIds, optimized, rendererInternals, isHydrating = false) { + if (!hasWarned) { + hasWarned = true; + console[console.info ? "info" : "log"]( + ` is an experimental feature and its API will likely change.` + ); + } + const { + p: patch, + m: move, + um: unmount, + n: next, + o: { parentNode, remove } + } = rendererInternals; + let parentSuspenseId; + const isSuspensible = isVNodeSuspensible(vnode); + if (isSuspensible) { + if (parentSuspense && parentSuspense.pendingBranch) { + parentSuspenseId = parentSuspense.pendingId; + parentSuspense.deps++; + } + } + const timeout = vnode.props ? toNumber(vnode.props.timeout) : void 0; + { + assertNumber(timeout, `Suspense timeout`); + } + const initialAnchor = anchor; + const suspense = { + vnode, + parent: parentSuspense, + parentComponent, + namespace, + container, + hiddenContainer, + deps: 0, + pendingId: suspenseId++, + timeout: typeof timeout === "number" ? timeout : -1, + activeBranch: null, + pendingBranch: null, + isInFallback: !isHydrating, + isHydrating, + isUnmounted: false, + effects: [], + resolve(resume = false, sync = false) { + { + if (!resume && !suspense.pendingBranch) { + throw new Error( + `suspense.resolve() is called without a pending branch.` + ); + } + if (suspense.isUnmounted) { + throw new Error( + `suspense.resolve() is called on an already unmounted suspense boundary.` + ); + } + } + const { + vnode: vnode2, + activeBranch, + pendingBranch, + pendingId, + effects, + parentComponent: parentComponent2, + container: container2 + } = suspense; + let delayEnter = false; + if (suspense.isHydrating) { + suspense.isHydrating = false; + } else if (!resume) { + delayEnter = activeBranch && pendingBranch.transition && pendingBranch.transition.mode === "out-in"; + if (delayEnter) { + activeBranch.transition.afterLeave = () => { + if (pendingId === suspense.pendingId) { + move( + pendingBranch, + container2, + anchor === initialAnchor ? next(activeBranch) : anchor, + 0 + ); + queuePostFlushCb(effects); + } + }; + } + if (activeBranch) { + if (parentNode(activeBranch.el) !== suspense.hiddenContainer) { + anchor = next(activeBranch); + } + unmount(activeBranch, parentComponent2, suspense, true); + } + if (!delayEnter) { + move(pendingBranch, container2, anchor, 0); + } + } + setActiveBranch(suspense, pendingBranch); + suspense.pendingBranch = null; + suspense.isInFallback = false; + let parent = suspense.parent; + let hasUnresolvedAncestor = false; + while (parent) { + if (parent.pendingBranch) { + parent.effects.push(...effects); + hasUnresolvedAncestor = true; + break; + } + parent = parent.parent; + } + if (!hasUnresolvedAncestor && !delayEnter) { + queuePostFlushCb(effects); + } + suspense.effects = []; + if (isSuspensible) { + if (parentSuspense && parentSuspense.pendingBranch && parentSuspenseId === parentSuspense.pendingId) { + parentSuspense.deps--; + if (parentSuspense.deps === 0 && !sync) { + parentSuspense.resolve(); + } + } + } + triggerEvent(vnode2, "onResolve"); + }, + fallback(fallbackVNode) { + if (!suspense.pendingBranch) { + return; + } + const { vnode: vnode2, activeBranch, parentComponent: parentComponent2, container: container2, namespace: namespace2 } = suspense; + triggerEvent(vnode2, "onFallback"); + const anchor2 = next(activeBranch); + const mountFallback = () => { + if (!suspense.isInFallback) { + return; + } + patch( + null, + fallbackVNode, + container2, + anchor2, + parentComponent2, + null, + // fallback tree will not have suspense context + namespace2, + slotScopeIds, + optimized + ); + setActiveBranch(suspense, fallbackVNode); + }; + const delayEnter = fallbackVNode.transition && fallbackVNode.transition.mode === "out-in"; + if (delayEnter) { + activeBranch.transition.afterLeave = mountFallback; + } + suspense.isInFallback = true; + unmount( + activeBranch, + parentComponent2, + null, + // no suspense so unmount hooks fire now + true + // shouldRemove + ); + if (!delayEnter) { + mountFallback(); + } + }, + move(container2, anchor2, type) { + suspense.activeBranch && move(suspense.activeBranch, container2, anchor2, type); + suspense.container = container2; + }, + next() { + return suspense.activeBranch && next(suspense.activeBranch); + }, + registerDep(instance, setupRenderEffect, optimized2) { + const isInPendingSuspense = !!suspense.pendingBranch; + if (isInPendingSuspense) { + suspense.deps++; + } + const hydratedEl = instance.vnode.el; + instance.asyncDep.catch((err) => { + handleError(err, instance, 0); + }).then((asyncSetupResult) => { + if (instance.isUnmounted || suspense.isUnmounted || suspense.pendingId !== instance.suspenseId) { + return; + } + instance.asyncResolved = true; + const { vnode: vnode2 } = instance; + { + pushWarningContext(vnode2); + } + handleSetupResult(instance, asyncSetupResult, false); + if (hydratedEl) { + vnode2.el = hydratedEl; + } + const placeholder = !hydratedEl && instance.subTree.el; + setupRenderEffect( + instance, + vnode2, + // component may have been moved before resolve. + // if this is not a hydration, instance.subTree will be the comment + // placeholder. + parentNode(hydratedEl || instance.subTree.el), + // anchor will not be used if this is hydration, so only need to + // consider the comment placeholder case. + hydratedEl ? null : next(instance.subTree), + suspense, + namespace, + optimized2 + ); + if (placeholder) { + remove(placeholder); + } + updateHOCHostEl(instance, vnode2.el); + { + popWarningContext(); + } + if (isInPendingSuspense && --suspense.deps === 0) { + suspense.resolve(); + } + }); + }, + unmount(parentSuspense2, doRemove) { + suspense.isUnmounted = true; + if (suspense.activeBranch) { + unmount( + suspense.activeBranch, + parentComponent, + parentSuspense2, + doRemove + ); + } + if (suspense.pendingBranch) { + unmount( + suspense.pendingBranch, + parentComponent, + parentSuspense2, + doRemove + ); + } + } + }; + return suspense; + } + function hydrateSuspense(node, vnode, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals, hydrateNode) { + const suspense = vnode.suspense = createSuspenseBoundary( + vnode, + parentSuspense, + parentComponent, + node.parentNode, + // eslint-disable-next-line no-restricted-globals + document.createElement("div"), + null, + namespace, + slotScopeIds, + optimized, + rendererInternals, + true + ); + const result = hydrateNode( + node, + suspense.pendingBranch = vnode.ssContent, + parentComponent, + suspense, + slotScopeIds, + optimized + ); + if (suspense.deps === 0) { + suspense.resolve(false, true); + } + return result; + } + function normalizeSuspenseChildren(vnode) { + const { shapeFlag, children } = vnode; + const isSlotChildren = shapeFlag & 32; + vnode.ssContent = normalizeSuspenseSlot( + isSlotChildren ? children.default : children + ); + vnode.ssFallback = isSlotChildren ? normalizeSuspenseSlot(children.fallback) : createVNode(Comment); + } + function normalizeSuspenseSlot(s) { + let block; + if (isFunction(s)) { + const trackBlock = isBlockTreeEnabled && s._c; + if (trackBlock) { + s._d = false; + openBlock(); + } + s = s(); + if (trackBlock) { + s._d = true; + block = currentBlock; + closeBlock(); + } + } + if (isArray(s)) { + const singleChild = filterSingleRoot(s); + if (!singleChild && s.filter((child) => child !== NULL_DYNAMIC_COMPONENT).length > 0) { + warn$1(` slots expect a single root node.`); + } + s = singleChild; + } + s = normalizeVNode(s); + if (block && !s.dynamicChildren) { + s.dynamicChildren = block.filter((c) => c !== s); + } + return s; + } + function queueEffectWithSuspense(fn, suspense) { + if (suspense && suspense.pendingBranch) { + if (isArray(fn)) { + suspense.effects.push(...fn); + } else { + suspense.effects.push(fn); + } + } else { + queuePostFlushCb(fn); + } + } + function setActiveBranch(suspense, branch) { + suspense.activeBranch = branch; + const { vnode, parentComponent } = suspense; + let el = branch.el; + while (!el && branch.component) { + branch = branch.component.subTree; + el = branch.el; + } + vnode.el = el; + if (parentComponent && parentComponent.subTree === vnode) { + parentComponent.vnode.el = el; + updateHOCHostEl(parentComponent, el); + } + } + function isVNodeSuspensible(vnode) { + const suspensible = vnode.props && vnode.props.suspensible; + return suspensible != null && suspensible !== false; + } + + function injectHook(type, hook, target = currentInstance, prepend = false) { + if (target) { + const hooks = target[type] || (target[type] = []); + const wrappedHook = hook.__weh || (hook.__weh = (...args) => { + pauseTracking(); + const reset = setCurrentInstance(target); + const res = callWithAsyncErrorHandling(hook, target, type, args); + reset(); + resetTracking(); + return res; + }); + if (prepend) { + hooks.unshift(wrappedHook); + } else { + hooks.push(wrappedHook); + } + return wrappedHook; + } else { + const apiName = toHandlerKey(ErrorTypeStrings$1[type].replace(/ hook$/, "")); + warn$1( + `${apiName} is called when there is no active component instance to be associated with. Lifecycle injection APIs can only be used during execution of setup().` + (` If you are using async setup(), make sure to register lifecycle hooks before the first await statement.` ) + ); + } + } + const createHook = (lifecycle) => (hook, target = currentInstance) => { + if (!isInSSRComponentSetup || lifecycle === "sp") { + injectHook(lifecycle, (...args) => hook(...args), target); + } + }; + const onBeforeMount = createHook("bm"); + const onMounted = createHook("m"); + const onBeforeUpdate = createHook("bu"); + const onUpdated = createHook("u"); + const onBeforeUnmount = createHook("bum"); + const onUnmounted = createHook("um"); + const onServerPrefetch = createHook("sp"); + const onRenderTriggered = createHook( + "rtg" + ); + const onRenderTracked = createHook( + "rtc" + ); + function onErrorCaptured(hook, target = currentInstance) { + injectHook("ec", hook, target); + } + + function validateDirectiveName(name) { + if (isBuiltInDirective(name)) { + warn$1("Do not use built-in directive ids as custom directive id: " + name); + } + } + function withDirectives(vnode, directives) { + if (currentRenderingInstance === null) { + warn$1(`withDirectives can only be used inside render functions.`); + return vnode; + } + const instance = getComponentPublicInstance(currentRenderingInstance); + const bindings = vnode.dirs || (vnode.dirs = []); + for (let i = 0; i < directives.length; i++) { + let [dir, value, arg, modifiers = EMPTY_OBJ] = directives[i]; + if (dir) { + if (isFunction(dir)) { + dir = { + mounted: dir, + updated: dir + }; + } + if (dir.deep) { + traverse(value); + } + bindings.push({ + dir, + instance, + value, + oldValue: void 0, + arg, + modifiers + }); + } + } + return vnode; + } + function invokeDirectiveHook(vnode, prevVNode, instance, name) { + const bindings = vnode.dirs; + const oldBindings = prevVNode && prevVNode.dirs; + for (let i = 0; i < bindings.length; i++) { + const binding = bindings[i]; + if (oldBindings) { + binding.oldValue = oldBindings[i].value; + } + let hook = binding.dir[name]; + if (hook) { + pauseTracking(); + callWithAsyncErrorHandling(hook, instance, 8, [ + vnode.el, + binding, + vnode, + prevVNode + ]); + resetTracking(); + } + } + } + + function renderList(source, renderItem, cache, index) { + let ret; + const cached = cache && cache[index]; + if (isArray(source) || isString(source)) { + ret = new Array(source.length); + for (let i = 0, l = source.length; i < l; i++) { + ret[i] = renderItem(source[i], i, void 0, cached && cached[i]); + } + } else if (typeof source === "number") { + if (!Number.isInteger(source)) { + warn$1(`The v-for range expect an integer value but got ${source}.`); + } + ret = new Array(source); + for (let i = 0; i < source; i++) { + ret[i] = renderItem(i + 1, i, void 0, cached && cached[i]); + } + } else if (isObject(source)) { + if (source[Symbol.iterator]) { + ret = Array.from( + source, + (item, i) => renderItem(item, i, void 0, cached && cached[i]) + ); + } else { + const keys = Object.keys(source); + ret = new Array(keys.length); + for (let i = 0, l = keys.length; i < l; i++) { + const key = keys[i]; + ret[i] = renderItem(source[key], key, i, cached && cached[i]); + } + } + } else { + ret = []; + } + if (cache) { + cache[index] = ret; + } + return ret; + } + + function createSlots(slots, dynamicSlots) { + for (let i = 0; i < dynamicSlots.length; i++) { + const slot = dynamicSlots[i]; + if (isArray(slot)) { + for (let j = 0; j < slot.length; j++) { + slots[slot[j].name] = slot[j].fn; + } + } else if (slot) { + slots[slot.name] = slot.key ? (...args) => { + const res = slot.fn(...args); + if (res) res.key = slot.key; + return res; + } : slot.fn; + } + } + return slots; + } + + /*! #__NO_SIDE_EFFECTS__ */ + // @__NO_SIDE_EFFECTS__ + function defineComponent(options, extraOptions) { + return isFunction(options) ? ( + // #8326: extend call and options.name access are considered side-effects + // by Rollup, so we have to wrap it in a pure-annotated IIFE. + /* @__PURE__ */ (() => extend({ name: options.name }, extraOptions, { setup: options }))() + ) : options; + } + + const isAsyncWrapper = (i) => !!i.type.__asyncLoader; + /*! #__NO_SIDE_EFFECTS__ */ + // @__NO_SIDE_EFFECTS__ + function defineAsyncComponent(source) { + if (isFunction(source)) { + source = { loader: source }; + } + const { + loader, + loadingComponent, + errorComponent, + delay = 200, + timeout, + // undefined = never times out + suspensible = true, + onError: userOnError + } = source; + let pendingRequest = null; + let resolvedComp; + let retries = 0; + const retry = () => { + retries++; + pendingRequest = null; + return load(); + }; + const load = () => { + let thisRequest; + return pendingRequest || (thisRequest = pendingRequest = loader().catch((err) => { + err = err instanceof Error ? err : new Error(String(err)); + if (userOnError) { + return new Promise((resolve, reject) => { + const userRetry = () => resolve(retry()); + const userFail = () => reject(err); + userOnError(err, userRetry, userFail, retries + 1); + }); + } else { + throw err; + } + }).then((comp) => { + if (thisRequest !== pendingRequest && pendingRequest) { + return pendingRequest; + } + if (!comp) { + warn$1( + `Async component loader resolved to undefined. If you are using retry(), make sure to return its return value.` + ); + } + if (comp && (comp.__esModule || comp[Symbol.toStringTag] === "Module")) { + comp = comp.default; + } + if (comp && !isObject(comp) && !isFunction(comp)) { + throw new Error(`Invalid async component load result: ${comp}`); + } + resolvedComp = comp; + return comp; + })); + }; + return defineComponent({ + name: "AsyncComponentWrapper", + __asyncLoader: load, + get __asyncResolved() { + return resolvedComp; + }, + setup() { + const instance = currentInstance; + if (resolvedComp) { + return () => createInnerComp(resolvedComp, instance); + } + const onError = (err) => { + pendingRequest = null; + handleError( + err, + instance, + 13, + !errorComponent + ); + }; + if (suspensible && instance.suspense || false) { + return load().then((comp) => { + return () => createInnerComp(comp, instance); + }).catch((err) => { + onError(err); + return () => errorComponent ? createVNode(errorComponent, { + error: err + }) : null; + }); + } + const loaded = ref(false); + const error = ref(); + const delayed = ref(!!delay); + if (delay) { + setTimeout(() => { + delayed.value = false; + }, delay); + } + if (timeout != null) { + setTimeout(() => { + if (!loaded.value && !error.value) { + const err = new Error( + `Async component timed out after ${timeout}ms.` + ); + onError(err); + error.value = err; + } + }, timeout); + } + load().then(() => { + loaded.value = true; + if (instance.parent && isKeepAlive(instance.parent.vnode)) { + instance.parent.effect.dirty = true; + queueJob(instance.parent.update); + } + }).catch((err) => { + onError(err); + error.value = err; + }); + return () => { + if (loaded.value && resolvedComp) { + return createInnerComp(resolvedComp, instance); + } else if (error.value && errorComponent) { + return createVNode(errorComponent, { + error: error.value + }); + } else if (loadingComponent && !delayed.value) { + return createVNode(loadingComponent); + } + }; + } + }); + } + function createInnerComp(comp, parent) { + const { ref: ref2, props, children, ce } = parent.vnode; + const vnode = createVNode(comp, props, children); + vnode.ref = ref2; + vnode.ce = ce; + delete parent.vnode.ce; + return vnode; + } + + function renderSlot(slots, name, props = {}, fallback, noSlotted) { + if (currentRenderingInstance.isCE || currentRenderingInstance.parent && isAsyncWrapper(currentRenderingInstance.parent) && currentRenderingInstance.parent.isCE) { + if (name !== "default") props.name = name; + return createVNode("slot", props, fallback && fallback()); + } + let slot = slots[name]; + if (slot && slot.length > 1) { + warn$1( + `SSR-optimized slot function detected in a non-SSR-optimized render function. You need to mark this component with $dynamic-slots in the parent template.` + ); + slot = () => []; + } + if (slot && slot._c) { + slot._d = false; + } + openBlock(); + const validSlotContent = slot && ensureValidVNode(slot(props)); + const rendered = createBlock( + Fragment, + { + key: props.key || // slot content array of a dynamic conditional slot may have a branch + // key attached in the `createSlots` helper, respect that + validSlotContent && validSlotContent.key || `_${name}` + }, + validSlotContent || (fallback ? fallback() : []), + validSlotContent && slots._ === 1 ? 64 : -2 + ); + if (!noSlotted && rendered.scopeId) { + rendered.slotScopeIds = [rendered.scopeId + "-s"]; + } + if (slot && slot._c) { + slot._d = true; + } + return rendered; + } + function ensureValidVNode(vnodes) { + return vnodes.some((child) => { + if (!isVNode(child)) return true; + if (child.type === Comment) return false; + if (child.type === Fragment && !ensureValidVNode(child.children)) + return false; + return true; + }) ? vnodes : null; + } + + function toHandlers(obj, preserveCaseIfNecessary) { + const ret = {}; + if (!isObject(obj)) { + warn$1(`v-on with no argument expects an object value.`); + return ret; + } + for (const key in obj) { + ret[preserveCaseIfNecessary && /[A-Z]/.test(key) ? `on:${key}` : toHandlerKey(key)] = obj[key]; + } + return ret; + } + + const getPublicInstance = (i) => { + if (!i) return null; + if (isStatefulComponent(i)) return getComponentPublicInstance(i); + return getPublicInstance(i.parent); + }; + const publicPropertiesMap = ( + // Move PURE marker to new line to workaround compiler discarding it + // due to type annotation + /* @__PURE__ */ extend(/* @__PURE__ */ Object.create(null), { + $: (i) => i, + $el: (i) => i.vnode.el, + $data: (i) => i.data, + $props: (i) => shallowReadonly(i.props) , + $attrs: (i) => shallowReadonly(i.attrs) , + $slots: (i) => shallowReadonly(i.slots) , + $refs: (i) => shallowReadonly(i.refs) , + $parent: (i) => getPublicInstance(i.parent), + $root: (i) => getPublicInstance(i.root), + $emit: (i) => i.emit, + $options: (i) => resolveMergedOptions(i) , + $forceUpdate: (i) => i.f || (i.f = () => { + i.effect.dirty = true; + queueJob(i.update); + }), + $nextTick: (i) => i.n || (i.n = nextTick.bind(i.proxy)), + $watch: (i) => instanceWatch.bind(i) + }) + ); + const isReservedPrefix = (key) => key === "_" || key === "$"; + const hasSetupBinding = (state, key) => state !== EMPTY_OBJ && !state.__isScriptSetup && hasOwn(state, key); + const PublicInstanceProxyHandlers = { + get({ _: instance }, key) { + if (key === "__v_skip") { + return true; + } + const { ctx, setupState, data, props, accessCache, type, appContext } = instance; + if (key === "__isVue") { + return true; + } + let normalizedProps; + if (key[0] !== "$") { + const n = accessCache[key]; + if (n !== void 0) { + switch (n) { + case 1 /* SETUP */: + return setupState[key]; + case 2 /* DATA */: + return data[key]; + case 4 /* CONTEXT */: + return ctx[key]; + case 3 /* PROPS */: + return props[key]; + } + } else if (hasSetupBinding(setupState, key)) { + accessCache[key] = 1 /* SETUP */; + return setupState[key]; + } else if (data !== EMPTY_OBJ && hasOwn(data, key)) { + accessCache[key] = 2 /* DATA */; + return data[key]; + } else if ( + // only cache other properties when instance has declared (thus stable) + // props + (normalizedProps = instance.propsOptions[0]) && hasOwn(normalizedProps, key) + ) { + accessCache[key] = 3 /* PROPS */; + return props[key]; + } else if (ctx !== EMPTY_OBJ && hasOwn(ctx, key)) { + accessCache[key] = 4 /* CONTEXT */; + return ctx[key]; + } else if (shouldCacheAccess) { + accessCache[key] = 0 /* OTHER */; + } + } + const publicGetter = publicPropertiesMap[key]; + let cssModule, globalProperties; + if (publicGetter) { + if (key === "$attrs") { + track(instance.attrs, "get", ""); + markAttrsAccessed(); + } else if (key === "$slots") { + track(instance, "get", key); + } + return publicGetter(instance); + } else if ( + // css module (injected by vue-loader) + (cssModule = type.__cssModules) && (cssModule = cssModule[key]) + ) { + return cssModule; + } else if (ctx !== EMPTY_OBJ && hasOwn(ctx, key)) { + accessCache[key] = 4 /* CONTEXT */; + return ctx[key]; + } else if ( + // global properties + globalProperties = appContext.config.globalProperties, hasOwn(globalProperties, key) + ) { + { + return globalProperties[key]; + } + } else if (currentRenderingInstance && (!isString(key) || // #1091 avoid internal isRef/isVNode checks on component instance leading + // to infinite warning loop + key.indexOf("__v") !== 0)) { + if (data !== EMPTY_OBJ && isReservedPrefix(key[0]) && hasOwn(data, key)) { + warn$1( + `Property ${JSON.stringify( + key + )} must be accessed via $data because it starts with a reserved character ("$" or "_") and is not proxied on the render context.` + ); + } else if (instance === currentRenderingInstance) { + warn$1( + `Property ${JSON.stringify(key)} was accessed during render but is not defined on instance.` + ); + } + } + }, + set({ _: instance }, key, value) { + const { data, setupState, ctx } = instance; + if (hasSetupBinding(setupState, key)) { + setupState[key] = value; + return true; + } else if (setupState.__isScriptSetup && hasOwn(setupState, key)) { + warn$1(`Cannot mutate