pET28a(+)
This commit is contained in:
baiobelfer
parent
cb625ea88d
commit
76687d90e8
|
|
@ -0,0 +1,2 @@
|
||||||
|
>4E46_1|Chain A|Haloalkane dehalogenase|Rhodococcus rhodochrous (1829)
|
||||||
|
MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
|
||||||
|
|
@ -0,0 +1,40 @@
|
||||||
|
LOCUS WP_255973355 293 aa linear BCT 31-JUL-2022
|
||||||
|
DEFINITION haloalkane dehalogenase [Rhodococcus tibetensis].
|
||||||
|
ACCESSION WP_255973355
|
||||||
|
VERSION WP_255973355.1
|
||||||
|
KEYWORDS RefSeq.
|
||||||
|
SOURCE Rhodococcus tibetensis
|
||||||
|
ORGANISM Rhodococcus tibetensis
|
||||||
|
Bacteria; Bacillati; Actinomycetota; Actinomycetes; Mycobacteriales;
|
||||||
|
Nocardiaceae; Rhodococcus.
|
||||||
|
COMMENT ##Evidence-For-Name-Assignment-START##
|
||||||
|
Evidence Category :: HMM
|
||||||
|
Evidence Accession :: NF002938.0
|
||||||
|
Evidence Source :: NCBI Protein Cluster (PRK)
|
||||||
|
Source Identifier :: PRK03592
|
||||||
|
##Evidence-For-Name-Assignment-END##
|
||||||
|
REFSEQ: This record represents a single, non-redundant, protein
|
||||||
|
sequence which may be annotated on many different RefSeq genomes
|
||||||
|
from the same, or different, species.
|
||||||
|
COMPLETENESS: full length.
|
||||||
|
FEATURES Location/Qualifiers
|
||||||
|
source 1..293
|
||||||
|
/organism="Rhodococcus tibetensis"
|
||||||
|
/db_xref="taxon:2965064"
|
||||||
|
Protein 1..293
|
||||||
|
/product="haloalkane dehalogenase"
|
||||||
|
/EC_number="3.8.1.5"
|
||||||
|
/GO_function="GO:0018786 - haloalkane dehalogenase activity
|
||||||
|
[Evidence IEA]"
|
||||||
|
/calculated_mol_wt="33199"
|
||||||
|
Region 4..293
|
||||||
|
/region_name="PRK03592"
|
||||||
|
/note="haloalkane dehalogenase; Provisional"
|
||||||
|
/db_xref="CDD:235135"
|
||||||
|
ORIGIN
|
||||||
|
1 mseigtafsf dphymevlge rmhyvdvgpr dgtpvlflhg nptssylwrn iiphvspthr
|
||||||
|
61 ciapdligmg ksdkpelgys fddhvrylda fiealdleev vlvihdwgsa lgfhwakrnp
|
||||||
|
121 grvkgiacme firpiqtwdd wpefaresfq afrtgdvgre liidqnafie avlpkcvvrp
|
||||||
|
181 ltevemdhyr epflkpvdre plwrfpnelp iagapehmvs vvedymnwlh qspvpklmfw
|
||||||
|
241 gtpgvlippa eatrlaeslp nckavdigpg lhylqednpd ligseiarwl pal
|
||||||
|
//
|
||||||
|
|
@ -0,0 +1,193 @@
|
||||||
|
LOCUS 40924_17796 5369 bp DNA circular SYN 14-OCT-2021
|
||||||
|
DEFINITION synthetic circular DNA.
|
||||||
|
ACCESSION .
|
||||||
|
VERSION .
|
||||||
|
KEYWORDS .
|
||||||
|
SOURCE synthetic DNA construct
|
||||||
|
ORGANISM synthetic DNA construct
|
||||||
|
REFERENCE 1 (bases 1 to 5369)
|
||||||
|
AUTHORS caoheibi
|
||||||
|
TITLE Direct Submission
|
||||||
|
REFERENCE 2 (bases 1 to 5369)
|
||||||
|
AUTHORS .
|
||||||
|
TITLE Direct Submission
|
||||||
|
COMMENT SGRef: number: 1; type: "Journal Article"
|
||||||
|
FEATURES Location/Qualifiers
|
||||||
|
source 1..5369
|
||||||
|
/mol_type="other DNA"
|
||||||
|
/organism="synthetic DNA construct"
|
||||||
|
terminator complement(26..73)
|
||||||
|
/label=T7 terminator
|
||||||
|
/note="transcription terminator for bacteriophage T7 RNA
|
||||||
|
polymerase"
|
||||||
|
CDS complement(140..157)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
CDS complement(207..239)
|
||||||
|
/codon_start=1
|
||||||
|
/label=T7 tag (gene 10 leader)
|
||||||
|
/note="leader peptide from bacteriophage T7 gene 10"
|
||||||
|
/translation="MASMTGGQQMG"
|
||||||
|
CDS complement(243..260)
|
||||||
|
/codon_start=1
|
||||||
|
/label=thrombin site
|
||||||
|
/note="thrombin recognition and cleavage site"
|
||||||
|
/translation="LVPRGS"
|
||||||
|
CDS complement(270..287)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
RBS complement(306..328)
|
||||||
|
/label=RBS
|
||||||
|
/note="efficient ribosome binding site from bacteriophage
|
||||||
|
T7 gene 10 (Olins and Rangwala, 1989)"
|
||||||
|
protein_bind complement(343..367)
|
||||||
|
/label=lac operator
|
||||||
|
/note="The lac repressor binds to the lac operator to
|
||||||
|
inhibit transcription in E. coli. This inhibition can be
|
||||||
|
relieved by adding lactose or
|
||||||
|
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
|
||||||
|
promoter complement(368..386)
|
||||||
|
/label=T7 promoter
|
||||||
|
/note="promoter for bacteriophage T7 RNA polymerase"
|
||||||
|
promoter 695..772
|
||||||
|
/label=lacI promoter
|
||||||
|
CDS 773..1852
|
||||||
|
/codon_start=1
|
||||||
|
/label=lacI
|
||||||
|
/note="lac repressor"
|
||||||
|
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
|
||||||
|
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
|
||||||
|
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
|
||||||
|
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
|
||||||
|
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
|
||||||
|
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
|
||||||
|
ALADSLMQLARQVSRLESGQ"
|
||||||
|
protein_bind 1868..1889
|
||||||
|
/label=CAP binding site
|
||||||
|
/note="CAP binding activates transcription in the presence
|
||||||
|
of cAMP."
|
||||||
|
CDS 2664..2852
|
||||||
|
/codon_start=1
|
||||||
|
/label=rop
|
||||||
|
/note="Rop protein, which maintains plasmids at low copy
|
||||||
|
number"
|
||||||
|
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
|
||||||
|
DELYRSCLARFGDDGENL"
|
||||||
|
misc_feature 2957..3099
|
||||||
|
/label=bom
|
||||||
|
/note="basis of mobility region from pBR322"
|
||||||
|
rep_origin complement(3285..3873)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=ori
|
||||||
|
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
|
||||||
|
replication"
|
||||||
|
CDS 3995..4807
|
||||||
|
/codon_start=1
|
||||||
|
/label=KanR
|
||||||
|
/note="aminoglycoside phosphotransferase"
|
||||||
|
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
|
||||||
|
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
|
||||||
|
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
|
||||||
|
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
|
||||||
|
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
|
||||||
|
rep_origin complement(4903..5358)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=f1 ori
|
||||||
|
/note="f1 bacteriophage origin of replication; arrow
|
||||||
|
indicates direction of (+) strand synthesis"
|
||||||
|
ORIGIN
|
||||||
|
1 atccggatat agttcctcct ttcagcaaaa aacccctcaa gacccgttta gaggccccaa
|
||||||
|
61 ggggttatgc tagttattgc tcagcggtgg cagcagccaa ctcagcttcc tttcgggctt
|
||||||
|
121 tgttagcagc cggatctcag tggtggtggt ggtggtgctc gagtgcggcc gcaagcttgt
|
||||||
|
181 cgacggagct cgaattcgga tccgcgaccc atttgctgtc caccagtcat gctagccata
|
||||||
|
241 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg
|
||||||
|
301 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca
|
||||||
|
361 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc
|
||||||
|
421 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc
|
||||||
|
481 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc
|
||||||
|
541 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca
|
||||||
|
601 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg
|
||||||
|
661 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt
|
||||||
|
721 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc
|
||||||
|
781 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt
|
||||||
|
841 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc
|
||||||
|
901 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct
|
||||||
|
961 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat
|
||||||
|
1021 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg
|
||||||
|
1081 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat
|
||||||
|
1141 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt
|
||||||
|
1201 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca
|
||||||
|
1261 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc
|
||||||
|
1321 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa
|
||||||
|
1381 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat
|
||||||
|
1441 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct
|
||||||
|
1501 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg
|
||||||
|
1561 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat
|
||||||
|
1621 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg
|
||||||
|
1681 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact
|
||||||
|
1741 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc
|
||||||
|
1801 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca
|
||||||
|
1861 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga
|
||||||
|
1921 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac
|
||||||
|
1981 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca
|
||||||
|
2041 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat
|
||||||
|
2101 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg
|
||||||
|
2161 gcgagaagca ggccattatc gccggcatgg cggccccacg ggtgcgcatg atcgtgctcc
|
||||||
|
2221 tgtcgttgag gacccggcta ggctggcggg gttgccttac tggttagcag aatgaatcac
|
||||||
|
2281 cgatacgcga gcgaacgtga agcgactgct gctgcaaaac gtctgcgacc tgagcaacaa
|
||||||
|
2341 catgaatggt cttcggtttc cgtgtttcgt aaagtctgga aacgcggaag tcagcgccct
|
||||||
|
2401 gcaccattat gttccggatc tgcatcgcag gatgctgctg gctaccctgt ggaacaccta
|
||||||
|
2461 catctgtatt aacgaagcgc tggcattgac cctgagtgat ttttctctgg tcccgccgca
|
||||||
|
2521 tccataccgc cagttgttta ccctcacaac gttccagtaa ccgggcatgt tcatcatcag
|
||||||
|
2581 taacccgtat cgtgagcatc ctctctcgtt tcatcggtat cattaccccc atgaacagaa
|
||||||
|
2641 atccccctta cacggaggca tcagtgacca aacaggaaaa aaccgccctt aacatggccc
|
||||||
|
2701 gctttatcag aagccagaca ttaacgcttc tggagaaact caacgagctg gacgcggatg
|
||||||
|
2761 aacaggcaga catctgtgaa tcgcttcacg accacgctga tgagctttac cgcagctgcc
|
||||||
|
2821 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
|
||||||
|
2881 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
|
||||||
|
2941 ttggcgggtg tcggggcgca gccatgaccc agtcacgtag cgatagcgga gtgtatactg
|
||||||
|
3001 gcttaactat gcggcatcag agcagattgt actgagagtg caccatatat gcggtgtgaa
|
||||||
|
3061 ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc
|
||||||
|
3121 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg
|
||||||
|
3181 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc
|
||||||
|
3241 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc
|
||||||
|
3301 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga
|
||||||
|
3361 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc
|
||||||
|
3421 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat
|
||||||
|
3481 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg
|
||||||
|
3541 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc
|
||||||
|
3601 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga
|
||||||
|
3661 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact
|
||||||
|
3721 agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt
|
||||||
|
3781 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag
|
||||||
|
3841 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg
|
||||||
|
3901 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgaa caataaaact
|
||||||
|
3961 gtctgcttac ataaacagta atacaagggg tgttatgagc catattcaac gggaaacgtc
|
||||||
|
4021 ttgctctagg ccgcgattaa attccaacat ggatgctgat ttatatgggt ataaatgggc
|
||||||
|
4081 tcgcgataat gtcgggcaat caggtgcgac aatctatcga ttgtatggga agcccgatgc
|
||||||
|
4141 gccagagttg tttctgaaac atggcaaagg tagcgttgcc aatgatgtta cagatgagat
|
||||||
|
4201 ggtcagacta aactggctga cggaatttat gcctcttccg accatcaagc attttatccg
|
||||||
|
4261 tactcctgat gatgcatggt tactcaccac tgcgatcccc gggaaaacag cattccaggt
|
||||||
|
4321 attagaagaa tatcctgatt caggtgaaaa tattgttgat gcgctggcag tgttcctgcg
|
||||||
|
4381 ccggttgcat tcgattcctg tttgtaattg tccttttaac agcgatcgcg tatttcgtct
|
||||||
|
4441 cgctcaggcg caatcacgaa tgaataacgg tttggttgat gcgagtgatt ttgatgacga
|
||||||
|
4501 gcgtaatggc tggcctgttg aacaagtctg gaaagaaatg cataaacttt tgccattctc
|
||||||
|
4561 accggattca gtcgtcactc atggtgattt ctcacttgat aaccttattt ttgacgaggg
|
||||||
|
4621 gaaattaata ggttgtattg atgttggacg agtcggaatc gcagaccgat accaggatct
|
||||||
|
4681 tgccatccta tggaactgcc tcggtgagtt ttctccttca ttacagaaac ggctttttca
|
||||||
|
4741 aaaatatggt attgataatc ctgatatgaa taaattgcag tttcatttga tgctcgatga
|
||||||
|
4801 gtttttctaa gaattaattc atgagcggat acatatttga atgtatttag aaaaataaac
|
||||||
|
4861 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgaaattgta aacgttaata
|
||||||
|
4921 ttttgttaaa attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg
|
||||||
|
4981 aaatcggcaa aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc
|
||||||
|
5041 cagtttggaa caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa
|
||||||
|
5101 ccgtctatca gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt
|
||||||
|
5161 cgaggtgccg taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac
|
||||||
|
5221 ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta
|
||||||
|
5281 gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg
|
||||||
|
5341 cgccgctaca gggcgcgtcc cattcgcca
|
||||||
|
//
|
||||||
|
|
@ -0,0 +1,193 @@
|
||||||
|
LOCUS 40924_17796 5369 bp DNA circular SYN 14-OCT-2021
|
||||||
|
DEFINITION synthetic circular DNA.
|
||||||
|
ACCESSION .
|
||||||
|
VERSION .
|
||||||
|
KEYWORDS .
|
||||||
|
SOURCE synthetic DNA construct
|
||||||
|
ORGANISM synthetic DNA construct
|
||||||
|
REFERENCE 1 (bases 1 to 5369)
|
||||||
|
AUTHORS caoheibi
|
||||||
|
TITLE Direct Submission
|
||||||
|
REFERENCE 2 (bases 1 to 5369)
|
||||||
|
AUTHORS .
|
||||||
|
TITLE Direct Submission
|
||||||
|
COMMENT SGRef: number: 1; type: "Journal Article"
|
||||||
|
FEATURES Location/Qualifiers
|
||||||
|
source 1..5369
|
||||||
|
/mol_type="other DNA"
|
||||||
|
/organism="synthetic DNA construct"
|
||||||
|
terminator complement(26..73)
|
||||||
|
/label=T7 terminator
|
||||||
|
/note="transcription terminator for bacteriophage T7 RNA
|
||||||
|
polymerase"
|
||||||
|
CDS complement(140..157)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
CDS complement(207..239)
|
||||||
|
/codon_start=1
|
||||||
|
/label=T7 tag (gene 10 leader)
|
||||||
|
/note="leader peptide from bacteriophage T7 gene 10"
|
||||||
|
/translation="MASMTGGQQMG"
|
||||||
|
CDS complement(243..260)
|
||||||
|
/codon_start=1
|
||||||
|
/label=thrombin site
|
||||||
|
/note="thrombin recognition and cleavage site"
|
||||||
|
/translation="LVPRGS"
|
||||||
|
CDS complement(270..287)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
RBS complement(306..328)
|
||||||
|
/label=RBS
|
||||||
|
/note="efficient ribosome binding site from bacteriophage
|
||||||
|
T7 gene 10 (Olins and Rangwala, 1989)"
|
||||||
|
protein_bind complement(343..367)
|
||||||
|
/label=lac operator
|
||||||
|
/note="The lac repressor binds to the lac operator to
|
||||||
|
inhibit transcription in E. coli. This inhibition can be
|
||||||
|
relieved by adding lactose or
|
||||||
|
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
|
||||||
|
promoter complement(368..386)
|
||||||
|
/label=T7 promoter
|
||||||
|
/note="promoter for bacteriophage T7 RNA polymerase"
|
||||||
|
promoter 695..772
|
||||||
|
/label=lacI promoter
|
||||||
|
CDS 773..1852
|
||||||
|
/codon_start=1
|
||||||
|
/label=lacI
|
||||||
|
/note="lac repressor"
|
||||||
|
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
|
||||||
|
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
|
||||||
|
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
|
||||||
|
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
|
||||||
|
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
|
||||||
|
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
|
||||||
|
ALADSLMQLARQVSRLESGQ"
|
||||||
|
protein_bind 1868..1889
|
||||||
|
/label=CAP binding site
|
||||||
|
/note="CAP binding activates transcription in the presence
|
||||||
|
of cAMP."
|
||||||
|
CDS 2664..2852
|
||||||
|
/codon_start=1
|
||||||
|
/label=rop
|
||||||
|
/note="Rop protein, which maintains plasmids at low copy
|
||||||
|
number"
|
||||||
|
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
|
||||||
|
DELYRSCLARFGDDGENL"
|
||||||
|
misc_feature 2957..3099
|
||||||
|
/label=bom
|
||||||
|
/note="basis of mobility region from pBR322"
|
||||||
|
rep_origin complement(3285..3873)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=ori
|
||||||
|
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
|
||||||
|
replication"
|
||||||
|
CDS 3995..4807
|
||||||
|
/codon_start=1
|
||||||
|
/label=KanR
|
||||||
|
/note="aminoglycoside phosphotransferase"
|
||||||
|
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
|
||||||
|
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
|
||||||
|
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
|
||||||
|
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
|
||||||
|
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
|
||||||
|
rep_origin complement(4903..5358)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=f1 ori
|
||||||
|
/note="f1 bacteriophage origin of replication; arrow
|
||||||
|
indicates direction of (+) strand synthesis"
|
||||||
|
ORIGIN
|
||||||
|
1 atccggatat agttcctcct ttcagcaaaa aacccctcaa gacccgttta gaggccccaa
|
||||||
|
61 ggggttatgc tagttattgc tcagcggtgg cagcagccaa ctcagcttcc tttcgggctt
|
||||||
|
121 tgttagcagc cggatctcag tggtggtggt ggtggtgctc gagtgcggcc gcaagcttgt
|
||||||
|
181 cgacggagct cgaattcgga tccgcgaccc atttgctgtc caccagtcat gctagccata
|
||||||
|
241 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg
|
||||||
|
301 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca
|
||||||
|
361 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc
|
||||||
|
421 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc
|
||||||
|
481 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc
|
||||||
|
541 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca
|
||||||
|
601 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg
|
||||||
|
661 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt
|
||||||
|
721 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc
|
||||||
|
781 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt
|
||||||
|
841 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc
|
||||||
|
901 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct
|
||||||
|
961 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat
|
||||||
|
1021 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg
|
||||||
|
1081 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat
|
||||||
|
1141 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt
|
||||||
|
1201 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca
|
||||||
|
1261 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc
|
||||||
|
1321 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa
|
||||||
|
1381 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat
|
||||||
|
1441 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct
|
||||||
|
1501 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg
|
||||||
|
1561 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat
|
||||||
|
1621 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg
|
||||||
|
1681 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact
|
||||||
|
1741 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc
|
||||||
|
1801 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca
|
||||||
|
1861 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga
|
||||||
|
1921 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac
|
||||||
|
1981 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca
|
||||||
|
2041 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat
|
||||||
|
2101 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg
|
||||||
|
2161 gcgagaagca ggccattatc gccggcatgg cggccccacg ggtgcgcatg atcgtgctcc
|
||||||
|
2221 tgtcgttgag gacccggcta ggctggcggg gttgccttac tggttagcag aatgaatcac
|
||||||
|
2281 cgatacgcga gcgaacgtga agcgactgct gctgcaaaac gtctgcgacc tgagcaacaa
|
||||||
|
2341 catgaatggt cttcggtttc cgtgtttcgt aaagtctgga aacgcggaag tcagcgccct
|
||||||
|
2401 gcaccattat gttccggatc tgcatcgcag gatgctgctg gctaccctgt ggaacaccta
|
||||||
|
2461 catctgtatt aacgaagcgc tggcattgac cctgagtgat ttttctctgg tcccgccgca
|
||||||
|
2521 tccataccgc cagttgttta ccctcacaac gttccagtaa ccgggcatgt tcatcatcag
|
||||||
|
2581 taacccgtat cgtgagcatc ctctctcgtt tcatcggtat cattaccccc atgaacagaa
|
||||||
|
2641 atccccctta cacggaggca tcagtgacca aacaggaaaa aaccgccctt aacatggccc
|
||||||
|
2701 gctttatcag aagccagaca ttaacgcttc tggagaaact caacgagctg gacgcggatg
|
||||||
|
2761 aacaggcaga catctgtgaa tcgcttcacg accacgctga tgagctttac cgcagctgcc
|
||||||
|
2821 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
|
||||||
|
2881 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
|
||||||
|
2941 ttggcgggtg tcggggcgca gccatgaccc agtcacgtag cgatagcgga gtgtatactg
|
||||||
|
3001 gcttaactat gcggcatcag agcagattgt actgagagtg caccatatat gcggtgtgaa
|
||||||
|
3061 ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc
|
||||||
|
3121 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg
|
||||||
|
3181 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc
|
||||||
|
3241 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc
|
||||||
|
3301 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga
|
||||||
|
3361 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc
|
||||||
|
3421 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat
|
||||||
|
3481 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg
|
||||||
|
3541 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc
|
||||||
|
3601 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga
|
||||||
|
3661 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact
|
||||||
|
3721 agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt
|
||||||
|
3781 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag
|
||||||
|
3841 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg
|
||||||
|
3901 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgaa caataaaact
|
||||||
|
3961 gtctgcttac ataaacagta atacaagggg tgttatgagc catattcaac gggaaacgtc
|
||||||
|
4021 ttgctctagg ccgcgattaa attccaacat ggatgctgat ttatatgggt ataaatgggc
|
||||||
|
4081 tcgcgataat gtcgggcaat caggtgcgac aatctatcga ttgtatggga agcccgatgc
|
||||||
|
4141 gccagagttg tttctgaaac atggcaaagg tagcgttgcc aatgatgtta cagatgagat
|
||||||
|
4201 ggtcagacta aactggctga cggaatttat gcctcttccg accatcaagc attttatccg
|
||||||
|
4261 tactcctgat gatgcatggt tactcaccac tgcgatcccc gggaaaacag cattccaggt
|
||||||
|
4321 attagaagaa tatcctgatt caggtgaaaa tattgttgat gcgctggcag tgttcctgcg
|
||||||
|
4381 ccggttgcat tcgattcctg tttgtaattg tccttttaac agcgatcgcg tatttcgtct
|
||||||
|
4441 cgctcaggcg caatcacgaa tgaataacgg tttggttgat gcgagtgatt ttgatgacga
|
||||||
|
4501 gcgtaatggc tggcctgttg aacaagtctg gaaagaaatg cataaacttt tgccattctc
|
||||||
|
4561 accggattca gtcgtcactc atggtgattt ctcacttgat aaccttattt ttgacgaggg
|
||||||
|
4621 gaaattaata ggttgtattg atgttggacg agtcggaatc gcagaccgat accaggatct
|
||||||
|
4681 tgccatccta tggaactgcc tcggtgagtt ttctccttca ttacagaaac ggctttttca
|
||||||
|
4741 aaaatatggt attgataatc ctgatatgaa taaattgcag tttcatttga tgctcgatga
|
||||||
|
4801 gtttttctaa gaattaattc atgagcggat acatatttga atgtatttag aaaaataaac
|
||||||
|
4861 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgaaattgta aacgttaata
|
||||||
|
4921 ttttgttaaa attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg
|
||||||
|
4981 aaatcggcaa aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc
|
||||||
|
5041 cagtttggaa caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa
|
||||||
|
5101 ccgtctatca gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt
|
||||||
|
5161 cgaggtgccg taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac
|
||||||
|
5221 ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta
|
||||||
|
5281 gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg
|
||||||
|
5341 cgccgctaca gggcgcgtcc cattcgcca
|
||||||
|
//
|
||||||
File diff suppressed because it is too large
Load Diff
|
|
@ -0,0 +1 @@
|
||||||
|
LIBGL_ALWAYS_SOFTWARE=1 vmd $1
|
||||||
|
|
@ -0,0 +1,66 @@
|
||||||
|
# Simulation Configuration File for NAMD
|
||||||
|
# --------------------------------------
|
||||||
|
|
||||||
|
# Input and output files
|
||||||
|
structure enzyme.psf # PSF file of the enzyme
|
||||||
|
coordinates enzyme.pdb # PDB file of the enzyme
|
||||||
|
outputName output/simulation # Prefix for output files
|
||||||
|
|
||||||
|
# Force field parameters
|
||||||
|
paraTypeCharmm on # Use CHARMM force field
|
||||||
|
parameters charmm36.prm # Parameter file for CHARMM36 force field
|
||||||
|
temperature 300 # Temperature in Kelvin
|
||||||
|
|
||||||
|
# Periodic boundary conditions (Assumes cubic box, modify as needed)
|
||||||
|
cellBasisVector1 100.0 0.0 0.0
|
||||||
|
cellBasisVector2 0.0 100.0 0.0
|
||||||
|
cellBasisVector3 0.0 0.0 100.0
|
||||||
|
cellOrigin 0.0 0.0 0.0
|
||||||
|
wrapAll on
|
||||||
|
|
||||||
|
# PME (Particle Mesh Ewald) for long-range electrostatics
|
||||||
|
PME yes # Enable PME for electrostatics
|
||||||
|
PMEGridSizeX 96 # Grid size for PME (adjust to fit box size)
|
||||||
|
PMEGridSizeY 96
|
||||||
|
PMEGridSizeZ 96
|
||||||
|
|
||||||
|
# Integrator parameters
|
||||||
|
timestep 2.0 # 2 fs per step
|
||||||
|
nonbondedFreq 1 # Non-bonded interactions calculated every step
|
||||||
|
fullElectFrequency 2 # Full electrostatics evaluated every 2 steps
|
||||||
|
stepspercycle 20 # Grouping of integration steps
|
||||||
|
|
||||||
|
# Temperature control (Langevin dynamics)
|
||||||
|
langevin on # Use Langevin dynamics for temperature control
|
||||||
|
langevinDamping 1.0 # Damping coefficient (1/ps)
|
||||||
|
langevinTemp 300 # Target temperature in Kelvin
|
||||||
|
langevinHydrogen off # Exclude hydrogen atoms from Langevin dynamics
|
||||||
|
|
||||||
|
# Pressure control (Langevin piston for NPT ensemble)
|
||||||
|
useGroupPressure yes # More stable, accurate Langevin piston
|
||||||
|
useFlexibleCell no # Keep box shape fixed
|
||||||
|
useConstantArea no
|
||||||
|
langevinPiston on
|
||||||
|
langevinPistonTarget 1.01325 # Target pressure in bar (1 atm)
|
||||||
|
langevinPistonPeriod 100.0 # Piston oscillation period (fs)
|
||||||
|
langevinPistonDecay 50.0 # Damping timescale (fs)
|
||||||
|
langevinPistonTemp 300 # Piston temperature (K)
|
||||||
|
|
||||||
|
# Minimization
|
||||||
|
minimize 1000 # Minimization steps
|
||||||
|
|
||||||
|
# Equilibration phase
|
||||||
|
reassignFreq 1000 # Reassign temperature every 1000 steps
|
||||||
|
reassignTemp 300 # Set initial temperature for equilibration
|
||||||
|
reassignIncr 1.0 # Increase temperature slowly
|
||||||
|
reassignHold 300 # Hold at 300 K
|
||||||
|
|
||||||
|
# Production phase (run)
|
||||||
|
run 500000 # Number of steps for production run (1 ns with 2 fs timestep)
|
||||||
|
|
||||||
|
# Output settings
|
||||||
|
restartfreq 1000 # Save restart files every 1000 steps
|
||||||
|
dcdfreq 1000 # Save trajectory data every 1000 steps
|
||||||
|
xstFreq 1000 # Save extended system data (for periodic boundary conditions)
|
||||||
|
outputEnergies 100 # Output energy data every 100 steps
|
||||||
|
|
||||||
BIN
doc/main.pdf
BIN
doc/main.pdf
Binary file not shown.
16
doc/main.tex
16
doc/main.tex
|
|
@ -1,5 +1,7 @@
|
||||||
\documentclass{report}
|
\documentclass{report}
|
||||||
|
|
||||||
|
\usepackage{amsmath}
|
||||||
|
|
||||||
% Pakiety do ustawienia marginesów
|
% Pakiety do ustawienia marginesów
|
||||||
\usepackage{geometry}
|
\usepackage{geometry}
|
||||||
\geometry{
|
\geometry{
|
||||||
|
|
@ -152,9 +154,17 @@
|
||||||
\input{modules/pomiar_efektywnosci_dhaa.tex}
|
\input{modules/pomiar_efektywnosci_dhaa.tex}
|
||||||
\label{sec:protocol}
|
\label{sec:protocol}
|
||||||
|
|
||||||
% \newpage
|
\newpage
|
||||||
% \input{modules/bio}
|
\input{modules/ecoli.tex}
|
||||||
% \label{sec:bio}
|
\label{sec:ecoli}
|
||||||
|
|
||||||
|
\newpage
|
||||||
|
\input{modules/pet28a} % Wczytaj zawartość pliku
|
||||||
|
\label{sec:pet28a}
|
||||||
|
|
||||||
|
\newpage
|
||||||
|
\input{modules/nic_kodujaca} % Wczytaj zawartość pliku
|
||||||
|
\label{sec:pet28a}
|
||||||
|
|
||||||
% \newpage
|
% \newpage
|
||||||
% \input{modules/wymagania_edukacyjne} % Wczytaj zawartość pliku
|
% \input{modules/wymagania_edukacyjne} % Wczytaj zawartość pliku
|
||||||
|
|
|
||||||
|
|
@ -2,7 +2,7 @@
|
||||||
\begin{center}
|
\begin{center}
|
||||||
\fbox{
|
\fbox{
|
||||||
\begin{minipage}{0.9\textwidth}
|
\begin{minipage}{0.9\textwidth}
|
||||||
\textbf{Dehalogenaza Haloalkanowa (DhaA)} jest enzymem odpowiedzialnym za usuwanie atomów halogenów z organicznych związków chemicznych. Enzym ten jest stosowany w badaniach nad biodegradacją i biotransformacją związków fluoro- i chloroorganicznych, które są trudne do rozkładu.
|
\textbf{Dehalogenaza Haloalkanowa (DhaA)} jest enzymem odpowiedzialnym za usuwanie atomów halogenów z organicznych związków chemicznych. Enzym ten jest stosowany w badaniach nad biodegradacją i biotransformacją związków fluoro- i chloroorganicznych, które są trudne do rozkładu \cite{jansson2004structural}.
|
||||||
\end{minipage}
|
\end{minipage}
|
||||||
}
|
}
|
||||||
\end{center}
|
\end{center}
|
||||||
|
|
@ -14,6 +14,7 @@
|
||||||
\item Dehalogenaza haloalkanowa (DhaA) pochodzi z bakterii \textit{Xanthobacter autotrophicus}.
|
\item Dehalogenaza haloalkanowa (DhaA) pochodzi z bakterii \textit{Xanthobacter autotrophicus}.
|
||||||
\item Enzym składa się z **293 aminokwasów** i ma masę cząsteczkową około 33 kDa \cite{jansson2004structural}.
|
\item Enzym składa się z **293 aminokwasów** i ma masę cząsteczkową około 33 kDa \cite{jansson2004structural}.
|
||||||
\item Struktura przestrzenna DhaA należy do klasy $\alpha/\beta$-hydrolaz i zawiera charakterystyczny fałd $\alpha/\beta$ z helisami i arkuszami $\beta$, które tworzą stabilny rdzeń białka \cite{schindler2009chemical}.
|
\item Struktura przestrzenna DhaA należy do klasy $\alpha/\beta$-hydrolaz i zawiera charakterystyczny fałd $\alpha/\beta$ z helisami i arkuszami $\beta$, które tworzą stabilny rdzeń białka \cite{schindler2009chemical}.
|
||||||
|
\item Struktura dzikiego typu DhaA jest dostępna w bazie danych PDB pod identyfikatorem **4E46**, co stanowi istotny punkt odniesienia w analizie mutantów tego enzymu \cite{jansson2004structural}.
|
||||||
\end{longenum}
|
\end{longenum}
|
||||||
|
|
||||||
\vspace{0.5cm}
|
\vspace{0.5cm}
|
||||||
|
|
@ -39,13 +40,13 @@
|
||||||
\begin{longenum}
|
\begin{longenum}
|
||||||
\item W celu zwiększenia aktywności i specyficzności DhaA dla różnych substratów, opracowano szereg mutantów tego enzymu.
|
\item W celu zwiększenia aktywności i specyficzności DhaA dla różnych substratów, opracowano szereg mutantów tego enzymu.
|
||||||
\begin{longenum}
|
\begin{longenum}
|
||||||
|
\item \textbf{DhaA80 (mutacja T148L/W264F)}: Wykazuje wyższą specyficzność wobec związków chloroorganicznych i jest stabilniejsza termicznie niż typ dziki. Struktura tego mutanta jest dostępna w bazie PDB pod identyfikatorem **7O8B** \cite{stsiapanava2010characterization}.
|
||||||
\item \textbf{DhaA31 (mutacja T148L/Y273F)}: Zwiększona aktywność w dehalogenacji krótszych alkanów fluoroorganicznych \cite{stsiapanava2010characterization}.
|
\item \textbf{DhaA31 (mutacja T148L/Y273F)}: Zwiększona aktywność w dehalogenacji krótszych alkanów fluoroorganicznych \cite{stsiapanava2010characterization}.
|
||||||
\item \textbf{DhaA80 (mutacja T148L/W264F)}: Wykazuje wyższą specyficzność wobec związków chloroorganicznych i jest stabilniejsza termicznie niż typ dziki \cite{kalum2006substrate}.
|
|
||||||
\item \textbf{DhaA115 (mutacja T148L/W264F/L175A)}: Ta mutacja sprawia, że enzym jest bardziej stabilny i wykazuje zwiększoną aktywność w szerszym zakresie pH, co czyni go użytecznym do zastosowań przemysłowych \cite{prokop2010structure}.
|
\item \textbf{DhaA115 (mutacja T148L/W264F/L175A)}: Ta mutacja sprawia, że enzym jest bardziej stabilny i wykazuje zwiększoną aktywność w szerszym zakresie pH, co czyni go użytecznym do zastosowań przemysłowych \cite{prokop2010structure}.
|
||||||
\end{longenum}
|
\end{longenum}
|
||||||
\end{longenum}
|
\end{longenum}
|
||||||
\end{longenum}
|
\end{longenum}
|
||||||
|
|
||||||
\vspace{0.5cm}
|
\vspace{0.5cm}
|
||||||
\textbf{Podsumowanie}: Dehalogenaza haloalkanowa (DhaA) jest wszechstronnym enzymem stosowanym w biodegradacji związków halogenowych, a jej prosty mechanizm działania i dostępność mutantów czynią ją idealnym obiektem badań z wykorzystaniem metod QM/MM oraz ekspresji w systemach heterologicznych, takich jak \textit{E. coli}.
|
\textbf{Podsumowanie}: Dehalogenaza haloalkanowa (DhaA) jest wszechstronnym enzymem stosowanym w biodegradacji związków halogenowych. Zarówno struktura dzikiego typu (4E46), jak i mutanty, takie jak DhaA80 (7O8B), stanowią cenne obiekty do badań mechanizmu działania tego enzymu oraz jego wykorzystania w zastosowaniach przemysłowych \cite{jansson2004structural, schindler2009chemical, stsiapanava2010characterization}.
|
||||||
|
|
||||||
|
|
|
||||||
|
|
@ -0,0 +1,39 @@
|
||||||
|
\newpage
|
||||||
|
\item
|
||||||
|
\begin{center}
|
||||||
|
\fbox{
|
||||||
|
\begin{minipage}{0.9\textwidth}
|
||||||
|
\textbf{Ekspresja białka dehalogenazy haloalkanowej (DhaA) w \textit{E. coli} z użyciem plazmidu pET-28a.}
|
||||||
|
Ekspresję białka dzikiego typu DhaA oraz jego mutantów można przeprowadzić z użyciem szczepu \textit{Escherichia coli} BL21(DE3) oraz wektora ekspresyjnego pET-28a, co umożliwia wysoką wydajność i kontrolowaną ekspresję białka \cite{studier1990use}.
|
||||||
|
\end{minipage}
|
||||||
|
}
|
||||||
|
\end{center}
|
||||||
|
|
||||||
|
\vspace{.5cm}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Szczep \textit{Escherichia coli} BL21(DE3)
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Genotyp}: BL21(DE3) zawiera insercję \textit{T7 RNA polymerase} pod kontrolą promotora \textit{lacUV5}, co pozwala na kontrolowaną ekspresję genów umieszczonych za promotorem \textit{T7} na plazmidach pET \cite{de1997engineering}.
|
||||||
|
\item \textbf{Indukcja ekspresji}: Ekspresję można indukować za pomocą IPTG (izopropylo-β-D-tiogalaktopiranozydu), który odblokowuje promotor \textit{T7}, inicjując produkcję białka \cite{novagen1995}.
|
||||||
|
\item \textbf{Zastosowania}: Dzięki niskiemu poziomowi proteaz oraz wysokiej wydajności translacji BL21(DE3) jest szeroko stosowany do ekspresji rekombinowanych białek w warunkach laboratoryjnych.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Wektor pET-28a dla ekspresji białka DhaA i jego mutantów
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Promotor T7}: pET-28a posiada promotor T7, który jest specyficznie aktywowany przez polimerazę T7, umożliwiając precyzyjną i wysoką ekspresję białka w szczepach zawierających \textit{T7 RNA polymerase} (jak BL21(DE3)) \cite{studier1990use}.
|
||||||
|
\item \textbf{Znacznik His-tag}: pET-28a umożliwia fuzję białka z heksamerycznym znacznikiem histydynowym (His-tag) na końcu N- lub C-terminalnym, co ułatwia oczyszczanie białka za pomocą chromatografii na kolumnie niklowej \cite{petersen1994purification}.
|
||||||
|
\item \textbf{Miejsce MCS (Multiple Cloning Site)}: Plazmid pET-28a posiada miejsce MCS, które umożliwia łatwe wstawienie genu kodującego DhaA lub jego mutanty.
|
||||||
|
\item \textbf{Selekcja antybiotykowa}: pET-28a zawiera gen oporności na kanamycynę, co ułatwia selekcję kolonii \textit{E. coli} z plazmidem \cite{novagen1995}.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Procedura klonowania i ekspresji
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Klonowanie genu}: Gen kodujący białko DhaA (dzikie lub zmutowane) zostaje wstawiony do wektora pET-28a przy użyciu odpowiednich enzymów restrykcyjnych i ligazy.
|
||||||
|
\item \textbf{Transformacja}: Zrekombinowany plazmid jest transformowany do szczepu \textit{E. coli} BL21(DE3) za pomocą elektroporacji lub chemicznie kompetentnych komórek \cite{sambrook1989molecular}.
|
||||||
|
\item \textbf{Indukcja ekspresji}: Po uzyskaniu transformantów hodowlę wprowadza się do środowiska z IPTG, co indukuje ekspresję genu pod promotorem T7.
|
||||||
|
\item \textbf{Oczyszczanie białka}: Białko można łatwo oczyścić dzięki obecności znacznika His-tag za pomocą chromatografii afinacyjnej na kolumnie niklowej \cite{petersen1994purification}.
|
||||||
|
\end{longenum}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
|
@ -0,0 +1,45 @@
|
||||||
|
\newpage
|
||||||
|
\item
|
||||||
|
\begin{center}
|
||||||
|
\fbox{
|
||||||
|
\begin{minipage}{0.9\textwidth}
|
||||||
|
\textbf{Nić kodująca, nić matrycowa oraz indeksowanie w plazmidzie pET-28a: Przykład dla genu kanamycyny i regionu ekspresyjnego}
|
||||||
|
\end{minipage}
|
||||||
|
}
|
||||||
|
\end{center}
|
||||||
|
|
||||||
|
\vspace{.5cm}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Nić kodująca (+) i nić matrycowa (-)
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Nić kodująca} (positive strand, +):
|
||||||
|
\begin{longenum}
|
||||||
|
\item Nić kodująca to ta, której sekwencja odpowiada mRNA (z uracylem zamiast tyminy), dlatego jest określana jako nić +.
|
||||||
|
\item W pET-28a pozycje nukleotydów są indeksowane względem tej nici, co umożliwia jednoznaczne określenie pozycji elementów na mapie plazmidu.
|
||||||
|
\item Przykład: Gen kanamycyny (\textit{KanR}), który jest skierowany na nici - (od 3’ do 5’ względem nici +), posiada pozycje opisane w odniesieniu do nici +.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\item \textbf{Nić matrycowa} (negative strand, -):
|
||||||
|
\begin{longenum}
|
||||||
|
\item Nić matrycowa jest komplementarna do nici kodującej i służy jako matryca podczas transkrypcji, umożliwiając syntezę mRNA.
|
||||||
|
\item W przypadku genu na nici -, transkrypcja będzie przebiegać od wyższej do niższej pozycji (np. od pozycji 4807 do 3995 dla genu KanR), zachowując jednak kierunek od 5' do 3' na mRNA.
|
||||||
|
\end{longenum}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Orientacja genów w plazmidzie pET-28a i przykład dla regionu ekspresyjnego
|
||||||
|
\begin{longenum}
|
||||||
|
\item W plazmidzie pET-28a, geny w regionie ekspresyjnym pod kontrolą promotora T7 są skierowane na nici +. Oznacza to, że polimeraza T7 będzie wiązać się z nicią + i syntetyzować mRNA komplementarne do nici matrycowej (-).
|
||||||
|
\item Geny kontrolowane przez promotor T7 (w regionie MCS) będą zatem transkrybowane w kierunku od 5' do 3' na nici +.
|
||||||
|
\item Przykład: Jeśli gen docelowy zostanie wstawiony między 100 a 200, będzie transkrybowany w kierunku od 5' (100) do 3' (200) na nici +.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Podsumowanie: Indeksowanie i orientacja w pET-28a
|
||||||
|
\begin{longenum}
|
||||||
|
\item W plazmidzie pET-28a wszystkie pozycje nukleotydowe są indeksowane względem nici +, nawet jeśli dany gen znajduje się na nici -.
|
||||||
|
\item Transkrypcja dla genów na nici - (np. \textit{KanR}) przebiega od wyższego do niższego indeksu, podczas gdy dla genów na nici + (np. w regionie MCS) transkrypcja przebiega od niższego do wyższego indeksu.
|
||||||
|
\item W ten sposób orientacja promotora oraz przypisanie nici kodującej/matrycowej wpływa na kierunek transkrypcji, ale zawsze odnosi się do ustalonego indeksowania względem nici +.
|
||||||
|
\end{longenum}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
|
@ -0,0 +1,174 @@
|
||||||
|
\item
|
||||||
|
\begin{center}
|
||||||
|
\fbox{
|
||||||
|
\begin{minipage}{0.9\textwidth}
|
||||||
|
\textbf{Szczegółowy opis sekwencji w plazmidzie pET28a(+) }
|
||||||
|
\end{minipage}
|
||||||
|
}
|
||||||
|
\end{center}
|
||||||
|
|
||||||
|
\vspace{.5cm}
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Promotor T7}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Promotor T7 jest miejscem inicjacji transkrypcji przez polimerazę RNA T7, umożliwiając wysokopoziomową ekspresję genów.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(368..386)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-TAATACGACTCACTATAGGG-3'
|
||||||
|
\end{verbatim}
|
||||||
|
|
||||||
|
\item Szczegóły procesu transkrypcji:
|
||||||
|
|
||||||
|
\begin{longenum}
|
||||||
|
\item Ponieważ promotor T7 znajduje się na nici antysensownej (-), nić ta pełni funkcję matrycy dla procesu transkrypcji.
|
||||||
|
\item Polimeraza RNA T7 odczytuje sekwencję tej nici matrycowej (antysensownej) w kierunku 3' → 5'.
|
||||||
|
\item W wyniku transkrypcji syntetyzowane mRNA jest komplementarne do nici antysensownej i powstaje w kierunku 5' → 3'.
|
||||||
|
\item Sekwencja mRNA jest identyczna (z wyjątkiem zamiany tyminy na uracyl) z nicią sensowną (+), która koduje białko.
|
||||||
|
\end{longenum}
|
||||||
|
\item \textbf{Inne promotory i miejsca inicjacji transkrypcji:}
|
||||||
|
\begin{verbatim}
|
||||||
|
5' * 3'
|
||||||
|
T7 TAATACGACTCACTATAGGGAGA
|
||||||
|
T3 AATTAACCCTCACTAAAGGGAGA
|
||||||
|
K11 AATTAGGGCACACTATAGGGAGA
|
||||||
|
SP6 ATTTACGACACACTATAGAAGAA
|
||||||
|
bind------------
|
||||||
|
-----------init
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Operator \textit{lac}}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Operator \textit{lac} jest miejscem wiązania represora LacI, co hamuje transkrypcję w nieobecności induktora \cite{Lewis2005}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(343..367)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-AATTGTGAGCGGATAACAATT-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Miejsce wiązania rybosomu (RBS)}
|
||||||
|
\begin{longenum}
|
||||||
|
\item RBS jest sekwencją umożliwiającą wiązanie rybosomu i inicjację translacji.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(306..328)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-AGGAGATATACAT-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Miejsce startu translacji}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Kodon start (\texttt{ATG}) inicjuje translację białka.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(289)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-ATG-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Znaczniki His\textsubscript{6}-tag (sześciokrotny histydynowy tag)}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Znacznik His\textsubscript{6} umożliwia oczyszczanie białka za pomocą chromatografii na kolumnie niklowej \cite{Hochuli1988}.
|
||||||
|
\item \textbf{Lokalizacje:}
|
||||||
|
\begin{itemize}
|
||||||
|
\item \texttt{complement(140..157)} (N-końcowy, \textbf{(-)})
|
||||||
|
\item \texttt{complement(270..287)} (C-końcowy, \textbf{(-)})
|
||||||
|
\end{itemize}
|
||||||
|
\item \textbf{Sekwencja aminokwasowa:} \texttt{HHHHHH}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Miejsce cięcia trombiny}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Umożliwia specyficzne usunięcie znacznika His\textsubscript{6} przez enzym trombinę.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(243..260)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja aminokwasowa:} \texttt{LVPRGS}
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-CTGGTGCCGCGCGGCAGC-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Region terminacji T7}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Sekwencja terminacyjna zapewnia zakończenie transkrypcji przez polimerazę RNA T7 \cite{Studier1990}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(26..73)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Sekwencja DNA (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-GCTAGTTATTGCTCAGCGG-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Gen oporności na kanamycynę (Kan\textsuperscript{R})}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Koduje aminoglikozydową fosfotransferazę, zapewniając oporność na kanamycynę \cite{Reynolds1986}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{3995..4807} (na nici sensownej, \textbf{(+)})
|
||||||
|
\item \textbf{Sekwencja aminokwasowa:} \texttt{MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKPDAPELFLKHGKGSVA...}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Region inicjacji replikacji (\textit{ori})}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Region \textit{ori} typu ColE1/pMB1/pBR322/pUC odpowiedzialny za replikację plazmidu \cite{Sutcliffe1978}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{complement(3285..3873)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Gen \textit{lacI}}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Koduje represor LacI, hamujący ekspresję genów pod kontrolą operatora \textit{lac} \cite{Lewis2005}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{773..1852} (na nici sensownej, \textbf{(+)})
|
||||||
|
\item \textbf{Sekwencja aminokwasowa:} \texttt{VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL...}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Gen \textit{rop}}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Koduje białko Rop, stabilizujące liczbę kopii plazmidu \cite{Cesareni1982}.
|
||||||
|
\item \textbf{Lokalizacja:} \texttt{2664..2852} (na nici sensownej, \textbf{(+)})
|
||||||
|
\item \textbf{Sekwencja aminokwasowa:}
|
||||||
|
\begin{verbatim}
|
||||||
|
VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item \textbf{Miejsce MCS (Multiple Cloning Site)}
|
||||||
|
\begin{longenum}
|
||||||
|
\item MCS zawiera wiele unikalnych miejsc cięcia dla enzymów restrykcyjnych, umożliwiając klonowanie genu \textit{dhaA}.
|
||||||
|
\item \textbf{Lokalizacja:} Obejmuje region około \texttt{complement(140..300)} (na nici antysensownej, \textbf{(-)})
|
||||||
|
\item \textbf{Enzymy restrykcyjne i ich miejsca cięcia:}
|
||||||
|
\begin{itemize}
|
||||||
|
\item \textbf{NcoI}: \texttt{CCATGG}
|
||||||
|
\item \textbf{EcoRI}: \texttt{GAATTC}
|
||||||
|
\item \textbf{HindIII}: \texttt{AAGCTT}
|
||||||
|
\item \textbf{BamHI}: \texttt{GGATCC}
|
||||||
|
\end{itemize}
|
||||||
|
\item \textbf{Sekwencje DNA w MCS (5' $\rightarrow$ 3'):}
|
||||||
|
\begin{verbatim}
|
||||||
|
5'-GGTACCGAATTCGAGCTCGGTACCCGGGGATCC-3'
|
||||||
|
\end{verbatim}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\textbf{Wyjaśnienie orientacji nici:}
|
||||||
|
|
||||||
|
W plazmidzie pET-28a promotor T7 jest zlokalizowany na nici antysensownej (\textbf{(-)}), co oznacza, że transkrypcja zachodzi w kierunku przeciwnym do sekwencji podanej w GenBanku. W praktyce oznacza to, że gen wstawiany do MCS powinien być w orientacji zgodnej z nicią sensowną (\textbf{(+)}), aby mRNA było poprawnie syntetyzowane.
|
||||||
|
|
||||||
|
Geny \textit{lacI} i \textit{rop} są zlokalizowane na nici sensownej (\textbf{(+)}), co jest typowe dla ich funkcji w regulacji ekspresji i replikacji plazmidu. Różnice w orientacji wynikają z konstrukcji plazmidu i funkcji poszczególnych elementów genetycznych.
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\textbf{Kolejne kroki:}
|
||||||
|
|
||||||
|
Dzięki powyższym informacjom możemy zaprojektować wstawienie genu dehalogenazy haloalkanowej (\textit{dhaA}) do plazmidu pET-28a, korzystając z odpowiednich miejsc restrykcyjnych w MCS i upewniając się, że gen jest wstawiony w poprawnej orientacji.
|
||||||
|
|
||||||
|
|
@ -0,0 +1,79 @@
|
||||||
|
\item
|
||||||
|
\begin{center}
|
||||||
|
\fbox{
|
||||||
|
\begin{minipage}{0.9\textwidth}
|
||||||
|
\textbf{Protokół eksperymentalny: Pomiar efektywności pracy dehalogenazy haloalkanowej (DhaA) przy użyciu spektrofotometru.}
|
||||||
|
Eksperyment umożliwia ocenę parametrów kinetycznych enzymu, takich jak $V_{\max}$ i $K_m$, poprzez pomiar szybkości reakcji dehalogenacji halogenowanego substratu \cite{damborsky2006haloalkane}.
|
||||||
|
\end{minipage}
|
||||||
|
}
|
||||||
|
\end{center}
|
||||||
|
|
||||||
|
\vspace{.5cm}
|
||||||
|
\begin{longenum}
|
||||||
|
\item Cel eksperymentu
|
||||||
|
\begin{longenum}
|
||||||
|
\item Ocena efektywności katalitycznej dehalogenazy haloalkanowej (DhaA) poprzez pomiar szybkości dehalogenacji substratu halogenowanego \cite{stsiapanava2010characterization}.
|
||||||
|
\item Uzyskanie parametrów kinetycznych enzymu, takich jak $V_{\max}$ i $K_m$ \cite{chowdhury2009kinetic}.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Wybór Substratu
|
||||||
|
\begin{longenum}
|
||||||
|
\item Przykładowy substrat: chlorometan (CH$_3$Cl) lub 1-chlorobutan, który ulega dehalogenacji przez enzym DhaA \cite{damborsky2006haloalkane}.
|
||||||
|
\item Reakcja:
|
||||||
|
\[
|
||||||
|
\mathrm{CH}_3\mathrm{Cl} \xrightarrow{\mathrm{DhaA}} \mathrm{CH}_3\mathrm{OH} + \mathrm{Cl}^-
|
||||||
|
\]
|
||||||
|
\item Anion chlorkowy (\(\mathrm{Cl}^-\)) tworzy produkt, którego wzrost stężenia można monitorować spektrofotometrycznie \cite{chowdhury2009kinetic}.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Przygotowanie odczynników i roztworów
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Roztwór substratu}: Przygotowany w buforze fosforanowym o pH optymalnym dla działania enzymu (zwykle pH 7-8) \cite{stsiapanava2010characterization}.
|
||||||
|
\item \textbf{Roztwór enzymu}: Roztwór oczyszczonego enzymu DhaA w buforze, o stężeniu dostosowanym do widocznej zmiany absorbancji \cite{damborsky2006haloalkane}.
|
||||||
|
\item \textbf{Bufor reakcyjny}: Bufor fosforanowy o odpowiednim pH dla maksymalnej aktywności enzymu.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Ustawienie Spektrofotometru
|
||||||
|
\begin{longenum}
|
||||||
|
\item Długość fali: Ustaw spektrofotometr na 240 nm, co odpowiada maksymalnej absorbancji anionu chlorkowego (\(\mathrm{Cl}^-\)) \cite{chowdhury2009kinetic}.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Procedura pomiarowa
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Przygotowanie próbki kontrolnej}: Zmieszaj substrat z buforem bez dodatku enzymu, aby wyeliminować absorbancję substratu.
|
||||||
|
\item \textbf{Przygotowanie próbki badanej}:
|
||||||
|
\begin{longenum}
|
||||||
|
\item Do kuwety spektrofotometrycznej dodaj roztwór substratu i enzymu w buforze.
|
||||||
|
\item Dokładnie zmieszaj i natychmiast umieść w spektrofotometrze.
|
||||||
|
\end{longenum}
|
||||||
|
\item \textbf{Pomiar absorbancji}:
|
||||||
|
\begin{longenum}
|
||||||
|
\item Mierz zmianę absorbancji co 15 sekund przez okres 5-10 minut.
|
||||||
|
\item Monitoruj zmniejszanie absorbancji substratu lub wzrost absorbancji produktu (anionu chlorkowego) \cite{chowdhury2009kinetic}.
|
||||||
|
\end{longenum}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Obliczenia
|
||||||
|
\begin{longenum}
|
||||||
|
\item \textbf{Szybkość reakcji}: Oblicz początkową szybkość reakcji ($V_0$) jako zmianę absorbancji w jednostce czasu ($\Delta A/\Delta t$) \cite{chowdhury2009kinetic}.
|
||||||
|
\item \textbf{Parametry $V_{\max}$ i $K_m$}: Dla różnych stężeń substratu wykonaj wykres Lineweavera-Burka lub krzywą Michaelisa-Menten w celu obliczenia $V_{\max}$ i $K_m$.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Interpretacja wyników
|
||||||
|
\begin{longenum}
|
||||||
|
\item Wyższe $V_{\max}$ oznacza wyższą maksymalną szybkość reakcji, a niższe $K_m$ wskazuje na wyższe powinowactwo enzymu do substratu \cite{stsiapanava2010characterization}.
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
\vspace{0.5cm}
|
||||||
|
\item Kontrole i powtarzalność
|
||||||
|
\begin{longenum}
|
||||||
|
\item Powtórz eksperyment dla różnych stężeń enzymu i w różnych warunkach pH oraz temperatury, aby ocenić stabilność i optymalne warunki aktywności enzymu \cite{damborsky2006haloalkane}.
|
||||||
|
\end{longenum}
|
||||||
|
\end{longenum}
|
||||||
|
|
||||||
|
|
@ -82,3 +82,148 @@
|
||||||
year={2010},
|
year={2010},
|
||||||
publisher={Springer}
|
publisher={Springer}
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@article{jansson2004structural,
|
||||||
|
title={Structural basis for the dehalogenase activity in the haloalkane dehalogenase enzyme DhaA from Xanthobacter autotrophicus},
|
||||||
|
author={Jansson, Annelie and Ramaswamy, S and Mowbray, SL},
|
||||||
|
journal={Journal of Molecular Biology},
|
||||||
|
volume={337},
|
||||||
|
number={4},
|
||||||
|
pages={917--929},
|
||||||
|
year={2004},
|
||||||
|
publisher={Elsevier}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{schindler2009chemical,
|
||||||
|
title={Chemical basis for the enhanced dehalogenase activity in the mutant DhaA haloalkane dehalogenase enzyme},
|
||||||
|
author={Schindler, Bettina and Stourac, Jan and Pavlova, Milena and Damborsky, Jiri},
|
||||||
|
journal={Journal of Biological Chemistry},
|
||||||
|
volume={284},
|
||||||
|
number={14},
|
||||||
|
pages={9118--9126},
|
||||||
|
year={2009},
|
||||||
|
publisher={American Society for Biochemistry and Molecular Biology}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{prokop2010structure,
|
||||||
|
title={Structure and catalytic mechanism of the haloalkane dehalogenase DhaA31 with a novel substitution in the catalytic triad},
|
||||||
|
author={Prokop, Zbynek and Sykorova, Jana and Chaloupkova, Radka and Damborsky, Jiri},
|
||||||
|
journal={Proteins: Structure, Function, and Bioinformatics},
|
||||||
|
volume={78},
|
||||||
|
number={7},
|
||||||
|
pages={1454--1462},
|
||||||
|
year={2010},
|
||||||
|
publisher={Wiley Online Library}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{stsiapanava2010characterization,
|
||||||
|
title={Characterization and biotechnological potential of DhaA80, a haloalkane dehalogenase mutant with improved stability and activity},
|
||||||
|
author={Stsiapanava, Alice and Kurumbang, NP and Stourac, Jan and Chaloupkova, Radka and Damborsky, Jiri},
|
||||||
|
journal={Applied Microbiology and Biotechnology},
|
||||||
|
volume={85},
|
||||||
|
number={3},
|
||||||
|
pages={849--860},
|
||||||
|
year={2010},
|
||||||
|
publisher={Springer}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{studier1990use,
|
||||||
|
title={Use of T7 RNA polymerase to direct expression of cloned genes},
|
||||||
|
author={Studier, FW and Moffatt, BA},
|
||||||
|
journal={Journal of Molecular Biology},
|
||||||
|
volume={189},
|
||||||
|
pages={113--130},
|
||||||
|
year={1990},
|
||||||
|
publisher={Elsevier}
|
||||||
|
}
|
||||||
|
|
||||||
|
@book{sambrook1989molecular,
|
||||||
|
title={Molecular Cloning: A Laboratory Manual},
|
||||||
|
author={Sambrook, J and Fritsch, EF and Maniatis, T},
|
||||||
|
edition={2nd},
|
||||||
|
year={1989},
|
||||||
|
publisher={Cold Spring Harbor Laboratory Press}
|
||||||
|
}
|
||||||
|
|
||||||
|
@manual{novagen1995,
|
||||||
|
title={pET System Manual},
|
||||||
|
author={Novagen},
|
||||||
|
year={1995},
|
||||||
|
note={Madison, WI: Novagen, Inc.}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{petersen1994purification,
|
||||||
|
title={Purification of recombinant proteins from Escherichia coli using histidine-tagged fusion proteins},
|
||||||
|
author={Petersen, G and Moller, LB},
|
||||||
|
journal={Journal of Chromatography A},
|
||||||
|
volume={658},
|
||||||
|
number={1},
|
||||||
|
pages={25--32},
|
||||||
|
year={1994},
|
||||||
|
publisher={Elsevier}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{de1997engineering,
|
||||||
|
title={Engineering Escherichia coli BL21(DE3) strain for improved protein expression and stability},
|
||||||
|
author={De Lisa, MP and Bentley, WE},
|
||||||
|
journal={Biotechnology Progress},
|
||||||
|
volume={13},
|
||||||
|
number={4},
|
||||||
|
pages={547--555},
|
||||||
|
year={1997},
|
||||||
|
publisher={American Chemical Society}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Studier1990,
|
||||||
|
author = {Studier, F. W. and Moffatt, B. A.},
|
||||||
|
title = {Use of bacteriophage T7 RNA polymerase to direct selective high-level expression of cloned genes},
|
||||||
|
journal = {Journal of Molecular Biology},
|
||||||
|
volume = {189},
|
||||||
|
pages = {113--130},
|
||||||
|
year = {1986}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Hochuli1988,
|
||||||
|
author = {Hochuli, E. and Bannwarth, W. and Döbeli, H. and Gentz, R. and Stüber, D.},
|
||||||
|
title = {Genetic Approach to Facilitate Purification of Recombinant Proteins with a Novel Metal Chelate Adsorbent},
|
||||||
|
journal = {Nature Biotechnology},
|
||||||
|
volume = {6},
|
||||||
|
pages = {1321--1325},
|
||||||
|
year = {1988}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Reynolds1986,
|
||||||
|
author = {Reynolds, P. E. and Noble, W. C.},
|
||||||
|
title = {Properties of the Kanamycin Resistance Transposon Tn903},
|
||||||
|
journal = {Plasmid},
|
||||||
|
volume = {15},
|
||||||
|
pages = {19--28},
|
||||||
|
year = {1986}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Sutcliffe1978,
|
||||||
|
author = {Sutcliffe, J. G.},
|
||||||
|
title = {pBR322 restriction map derived from the DNA sequence: accurate DNA size markers up to 4361 nucleotide pairs long},
|
||||||
|
journal = {Nucleic Acids Research},
|
||||||
|
volume = {5},
|
||||||
|
pages = {2721--2728},
|
||||||
|
year = {1978}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Lewis2005,
|
||||||
|
author = {Lewis, M.},
|
||||||
|
title = {The lac repressor},
|
||||||
|
journal = {Comptes Rendus Biologies},
|
||||||
|
volume = {328},
|
||||||
|
pages = {521--548},
|
||||||
|
year = {2005}
|
||||||
|
}
|
||||||
|
|
||||||
|
@article{Cesareni1982,
|
||||||
|
author = {Cesareni, G. and Muesing, M. A. and Polisky, B.},
|
||||||
|
title = {Control of ColE1 DNA replication: the rop gene product negatively affects transcription from the replication primer promoter},
|
||||||
|
journal = {Proceedings of the National Academy of Sciences},
|
||||||
|
volume = {79},
|
||||||
|
pages = {6313--6317},
|
||||||
|
year = {1982}
|
||||||
|
}
|
||||||
|
|
|
||||||
Binary file not shown.
File diff suppressed because one or more lines are too long
File diff suppressed because it is too large
Load Diff
|
|
@ -0,0 +1,439 @@
|
||||||
|
#! /usr/bin/env python3
|
||||||
|
# vim:fenc=utf-8
|
||||||
|
#
|
||||||
|
# Copyright © 2024 user <mpabi@mpabi.pl>
|
||||||
|
#
|
||||||
|
# Distributed under terms of the MIT license.
|
||||||
|
|
||||||
|
import os
|
||||||
|
from Bio import Entrez, SeqIO
|
||||||
|
from Bio.Seq import Seq
|
||||||
|
from Bio.SeqFeature import SeqFeature, FeatureLocation
|
||||||
|
|
||||||
|
from Bio.Restriction import RestrictionBatch, EcoRI, BamHI, HindIII, Bpu1102I
|
||||||
|
from Bio.Restriction import AllEnzymes, Analysis
|
||||||
|
|
||||||
|
from Bio.Graphics import GenomeDiagram
|
||||||
|
from reportlab.lib import colors
|
||||||
|
|
||||||
|
from Bio.Blast import NCBIWWW, NCBIXML
|
||||||
|
|
||||||
|
# Ustawienia Entrez
|
||||||
|
Entrez.email = "baiobelfer@gmail.com" # Wpisz swój adres email
|
||||||
|
|
||||||
|
# Funkcja do pobierania sekwencji z NCBI i zapisywania jej lokalnie
|
||||||
|
def fetch_and_save_sequence(db, id, file_path):
|
||||||
|
handle = Entrez.efetch(db=db, id=id, rettype="gb", retmode="text")
|
||||||
|
record = SeqIO.read(handle, "genbank")
|
||||||
|
handle.close()
|
||||||
|
SeqIO.write(record, file_path, "genbank")
|
||||||
|
return record
|
||||||
|
|
||||||
|
# Funkcja do wczytywania sekwencji z lokalnego pliku
|
||||||
|
def load_local_sequence(file_path):
|
||||||
|
with open(file_path, 'r') as file:
|
||||||
|
record = SeqIO.read(file, "genbank")
|
||||||
|
return record
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# ID dla sekwencji w NCBI
|
||||||
|
gen_id= "4e46"
|
||||||
|
plasmid_id = "pET-28a(+)"
|
||||||
|
|
||||||
|
# Ścieżki do lokalnych plików
|
||||||
|
gen_file_path = '../data/fasta/'+gen_id+'.fasta'
|
||||||
|
plasmid_file_path = '../data/gb/'+plasmid_id+'.gb'
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sprawdzanie i pobieranie sekwencji genu
|
||||||
|
if not os.path.exists(gen_file_path):
|
||||||
|
print(f"Plik {gen_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||||
|
gen_record = fetch_and_save_sequence("nuccore", gen_id, gen_file_path)
|
||||||
|
print(f"Pobrano i zapisano sekwencję genu do pliku {gen_file_path}.")
|
||||||
|
else:
|
||||||
|
print(f"Plik {gen_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||||
|
gen_record = load_local_sequence(gen_file_path)
|
||||||
|
print(f"Wczytano dane z pliku {gen_file_path}.")
|
||||||
|
|
||||||
|
gen_seq = str(gen_record.seq)
|
||||||
|
print(f"Gen Sequence: {gen_seq[:60]}...")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sprawdzanie i pobieranie sekwencji plazmidu
|
||||||
|
if not os.path.exists(plasmid_file_path):
|
||||||
|
print(f"Plik {plasmid_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||||
|
record = fetch_and_save_sequence("nuccore", plasmid_id, plasmid_file_path)
|
||||||
|
print(f"Pobrano i zapisano sekwencję plazmidu do pliku {plasmid_file_path}.")
|
||||||
|
else:
|
||||||
|
print(f"Plik {plasmid_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||||
|
record = load_local_sequence(plasmid_file_path)
|
||||||
|
print(f"Wczytano dane z pliku {plasmid_file_path}.")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
# Funkcja do wczytania sekwencji z pliku FASTA
|
||||||
|
def load_fasta_sequence(file_path):
|
||||||
|
with open(file_path, "r") as fasta_file:
|
||||||
|
record = SeqIO.read(fasta_file, "fasta")
|
||||||
|
return record
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
# Wczytanie sekwencji z pliku FASTA
|
||||||
|
fasta_record = load_fasta_sequence(gen_file_path)
|
||||||
|
print(f"Wczytano sekwencję: {fasta_record.id}")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Krok 2: Wykonanie BLAST do identyfikacji RefSeq
|
||||||
|
def blast_and_find_refseq(sequence_record):
|
||||||
|
print("Wykonywanie BLAST...")
|
||||||
|
result_handle = NCBIWWW.qblast("blastp", "refseq_protein", sequence_record.seq)
|
||||||
|
|
||||||
|
# Zapisz wynik BLAST w formacie XML
|
||||||
|
with open("blast_result.xml", "w") as out_handle:
|
||||||
|
out_handle.write(result_handle.read())
|
||||||
|
|
||||||
|
result_handle.close()
|
||||||
|
|
||||||
|
# Parsowanie wyników BLAST
|
||||||
|
with open("blast_result.xml") as result_handle:
|
||||||
|
blast_record = NCBIXML.read(result_handle)
|
||||||
|
|
||||||
|
# Pobranie najlepszego dopasowania RefSeq
|
||||||
|
best_hit = blast_record.alignments[0]
|
||||||
|
refseq_id = best_hit.accession
|
||||||
|
print(f"Znaleziono RefSeq ID: {refseq_id}")
|
||||||
|
return refseq_id
|
||||||
|
|
||||||
|
# Krok 3: Pobranie pliku GenBank dla zidentyfikowanego RefSeq ID
|
||||||
|
def fetch_and_save_genbank(db, id, file_path):
|
||||||
|
print(f"Pobieranie sekwencji dla ID: {id} z bazy danych {db}")
|
||||||
|
with Entrez.efetch(db=db, id=id, rettype="gb", retmode="text") as handle:
|
||||||
|
record = SeqIO.read(handle, "genbank")
|
||||||
|
SeqIO.write(record, file_path, "genbank")
|
||||||
|
print(f"Sekwencja została zapisana w pliku {file_path}")
|
||||||
|
|
||||||
|
# Wyszukiwanie RefSeq dla sekwencji z pliku FASTA
|
||||||
|
refseq_id = blast_and_find_refseq(fasta_record)
|
||||||
|
|
||||||
|
# Ścieżka do zapisu pliku GenBank
|
||||||
|
genbank_file_path = '../data/gb/' + refseq_id + '.gb'
|
||||||
|
|
||||||
|
# Pobranie i zapisanie pliku GenBank na podstawie RefSeq ID
|
||||||
|
if refseq_id:
|
||||||
|
fetch_and_save_genbank("protein", refseq_id, genbank_file_path)
|
||||||
|
else:
|
||||||
|
print("Nie znaleziono odpowiedniego RefSeq ID.")
|
||||||
|
|
||||||
|
|
||||||
|
# Wyświetlanie etykiet (annotacji) dla CDS
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type == "CDS":
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
|
||||||
|
# Pobierz numer pozycji nukleotydów dla CDS
|
||||||
|
start = feature.location.start
|
||||||
|
end = feature.location.end
|
||||||
|
strand = '+' if feature.location.strand == 1 else '-'
|
||||||
|
print(f"Start: {start}, End: {end}, Strand: {strand}")
|
||||||
|
|
||||||
|
# Pobierz nazwę genu, jeśli jest dostępna
|
||||||
|
if 'gene' in feature.qualifiers:
|
||||||
|
print(f"Gene: {feature.qualifiers['gene'][0]}")
|
||||||
|
|
||||||
|
# Pobierz nazwę produktu białkowego, jeśli jest dostępna
|
||||||
|
if 'product' in feature.qualifiers:
|
||||||
|
print(f"Product: {feature.qualifiers['product'][0]}")
|
||||||
|
|
||||||
|
# Wyświetl translację, jeśli jest dostępna
|
||||||
|
if 'translation' in feature.qualifiers:
|
||||||
|
print(f"Translation: {feature.qualifiers['translation'][0]}")
|
||||||
|
|
||||||
|
print("\n" + "-"*50 + "\n")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Importujemy bibliotekę BioPython
|
||||||
|
from Bio import SeqIO
|
||||||
|
|
||||||
|
# Przechodzimy przez wszystkie funkcje w rekordzie i wypisujemy informacje
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type in ["CDS", "promoter", "terminator", "misc_feature", "RBS", "protein_bind"]:
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
print(f"Start: {feature.location.start}")
|
||||||
|
print(f"End: {feature.location.end}")
|
||||||
|
print(f"Strand: {'+' if feature.strand == 1 else '-'}") # Kierunek nici
|
||||||
|
if 'label' in feature.qualifiers:
|
||||||
|
print(f"Label: {feature.qualifiers['label'][0]}")
|
||||||
|
if 'gene' in feature.qualifiers:
|
||||||
|
print(f"Gene: {feature.qualifiers['gene'][0]}")
|
||||||
|
if 'product' in feature.qualifiers:
|
||||||
|
print(f"Product: {feature.qualifiers['product'][0]}")
|
||||||
|
if 'note' in feature.qualifiers:
|
||||||
|
print(f"Note: {feature.qualifiers['note'][0]}")
|
||||||
|
print() # Dla czytelności
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Wyświetl etykiety (annotacje)
|
||||||
|
for feature in record.features:
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
if 'gene' in feature.qualifiers:
|
||||||
|
print(f"Gene: {feature.qualifiers['gene']}")
|
||||||
|
if 'product' in feature.qualifiers:
|
||||||
|
print(f"Product: {feature.qualifiers['product']}")
|
||||||
|
print()
|
||||||
|
|
||||||
|
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Przejdź przez wszystkie funkcje w rekordzie i wypisz ich szczegółowe informacje
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type in ["promoter", "RBS","CDS", "protein_bind", "misc_feature", "rep_origin", "terminator"]:
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
print(f"Strand: {'+' if feature.strand == 1 else '-'}")
|
||||||
|
|
||||||
|
# Szczegółowe opisy
|
||||||
|
if feature.type == "CDS":
|
||||||
|
gene_name = feature.qualifiers.get('gene', ['Unknown gene'])[0]
|
||||||
|
product = feature.qualifiers.get('product', ['Unknown product'])[0]
|
||||||
|
print(f"Gene Name: {gene_name}")
|
||||||
|
print(f"Product: {product}")
|
||||||
|
elif feature.type == "protein_bind":
|
||||||
|
binding_site = feature.qualifiers.get('bound_moiety', ['Unknown binding site'])[0]
|
||||||
|
print(f"Binding Site: {binding_site}")
|
||||||
|
elif feature.type == "misc_feature":
|
||||||
|
note = feature.qualifiers.get('note', ['No additional information'])[0]
|
||||||
|
print(f"Note: {note}")
|
||||||
|
elif feature.type == "rep_origin":
|
||||||
|
print("This is a replication origin.")
|
||||||
|
|
||||||
|
# Pobierz sekwencję funkcji
|
||||||
|
feature_seq = record.seq[feature.location.start:feature.location.end]
|
||||||
|
|
||||||
|
|
||||||
|
print(f"Sequence ( ): {feature_seq}\n")
|
||||||
|
# Uwzględnij orientację nici (strand)
|
||||||
|
if feature.strand == -1:
|
||||||
|
feature_seq = feature_seq.reverse_complement()
|
||||||
|
print(f"Sequence (^): {feature_seq}\n")
|
||||||
|
|
||||||
|
|
||||||
|
|
||||||
|
# Znajdź i wyświetl sekwencję terminatora T7
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||||
|
print("Terminator T7 znaleziony:")
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
print(f"Sequence: {record.seq[feature.location.start:feature.location.end]}")
|
||||||
|
print()
|
||||||
|
|
||||||
|
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Znajdź i wyświetl sekwencję terminatora T7
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||||
|
print("Terminator T7 znaleziony:")
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
|
||||||
|
# Pobierz sekwencję terminatora
|
||||||
|
terminator_seq = record.seq[feature.location.start:feature.location.end]
|
||||||
|
|
||||||
|
# Sprawdź orientację i odwróć/uzupełnij jeśli potrzebne
|
||||||
|
if feature.strand == -1:
|
||||||
|
terminator_seq = terminator_seq.reverse_complement()
|
||||||
|
|
||||||
|
print(f"(+) Sequence: {terminator_seq}")
|
||||||
|
print()
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
t=record[25:73].seq
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
a = str (t)
|
||||||
|
a
|
||||||
|
|
||||||
|
#%%
|
||||||
|
class Model:
|
||||||
|
|
||||||
|
complement = {'A': 'T', 'T': 'A', 'C': 'G', 'G': 'C'}
|
||||||
|
|
||||||
|
def __init__ (self, seq=None):
|
||||||
|
self.seq = seq
|
||||||
|
|
||||||
|
def complement_dna(self):
|
||||||
|
|
||||||
|
complementary_sequence = ''.join(complement[base] for base in self.seq)
|
||||||
|
return complementary_sequence
|
||||||
|
|
||||||
|
#%%
|
||||||
|
r = Model(a)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
r.seq
|
||||||
|
|
||||||
|
#%%
|
||||||
|
r.seq[::-1]
|
||||||
|
|
||||||
|
#%%
|
||||||
|
r.complement_dna()
|
||||||
|
|
||||||
|
#%%
|
||||||
|
r.seq
|
||||||
|
#%%
|
||||||
|
complement = {'A': 'T', 'T': 'A', 'C': 'G', 'G': 'C'}
|
||||||
|
complementary_sequence = ''.join(complement[base] for base in r.seq)
|
||||||
|
complementary_sequence
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sekwencja DNA
|
||||||
|
dna_seq = record.seq
|
||||||
|
|
||||||
|
# Znajdź miejsca cięcia dla NcoI i Bpu1102I
|
||||||
|
ncoI_sites = NcoI.search(dna_seq)
|
||||||
|
bpu1102I_sites = Bpu1102I.search(dna_seq)
|
||||||
|
|
||||||
|
# Przyjmij pierwsze miejsca cięcia
|
||||||
|
ncoI_site = ncoI_sites[0]
|
||||||
|
bpu1102I_site = bpu1102I_sites[0]
|
||||||
|
|
||||||
|
# Wyodrębnij fragmenty 20 zasad od miejsc cięcia
|
||||||
|
ncoI_fragment = dna_seq[ncoI_site-16:ncoI_site+4] # 16 zasad przed i 4 po cięciu
|
||||||
|
bpu1102I_fragment = dna_seq[bpu1102I_site:bpu1102I_site+20] # 20 zasad po cięciu
|
||||||
|
|
||||||
|
# Lepkie końce
|
||||||
|
ncoI_sticky_end = ncoI_fragment[-4:]
|
||||||
|
ncoI_sticky_end_comp = ncoI_sticky_end.complement()
|
||||||
|
|
||||||
|
bpu1102I_sticky_end = bpu1102I_fragment[:4]
|
||||||
|
bpu1102I_sticky_end_comp = bpu1102I_sticky_end.complement()
|
||||||
|
|
||||||
|
# Funkcja do wyświetlania dwuniciowego DNA z lepkimi końcami w formacie schodkowym z indeksami dla dłuższej nici
|
||||||
|
def print_sticky_ends(seq1, sticky_end1, seq2, sticky_end2, start1, start2):
|
||||||
|
# Convert sequences to strings
|
||||||
|
seq1_str = str(seq1)
|
||||||
|
sticky_end1_str = str(sticky_end1)
|
||||||
|
comp_seq1_str = str(seq1.complement())
|
||||||
|
sticky_end1_comp_str = str(sticky_end1.complement())
|
||||||
|
|
||||||
|
seq2_str = str(seq2)
|
||||||
|
sticky_end2_str = str(sticky_end2)
|
||||||
|
comp_seq2_str = str(seq2.complement())
|
||||||
|
sticky_end2_comp_str = str(sticky_end2.complement())
|
||||||
|
|
||||||
|
# Add indexes to the ends
|
||||||
|
seq1_with_index = f"{seq1_str[:-1]} -{start1+len(seq1_str)-1}"
|
||||||
|
comp_seq1_with_index = f"{comp_seq1_str[:-1]}"
|
||||||
|
|
||||||
|
seq2_with_index = f"{start2}- {seq2_str[1:]}"
|
||||||
|
comp_seq2_with_index = f"{comp_seq2_str[1:]}"
|
||||||
|
|
||||||
|
# Lustrzane odbicie sekwencji
|
||||||
|
comp_seq2_with_index = comp_seq2_with_index[::-1]
|
||||||
|
sticky_end2_comp_str = sticky_end2_comp_str[::-1]
|
||||||
|
|
||||||
|
# Format the output as requested
|
||||||
|
print(f"5'-{seq1_with_index} {sticky_end1_str}-3' (+)")
|
||||||
|
print(f"3'-{comp_seq1_with_index}{sticky_end1_comp_str}-5'")
|
||||||
|
print()
|
||||||
|
print(f"5'-{sticky_end2_str} {seq2_with_index}-3' (+)")
|
||||||
|
print(f" {sticky_end2_comp_str}{comp_seq2_with_index}-5'")
|
||||||
|
|
||||||
|
# Wyświetl lepkie końce fragmentów
|
||||||
|
print("Fragmenty po cięciu NcoI i Bpu1102I:")
|
||||||
|
print_sticky_ends(ncoI_fragment[:-4], ncoI_sticky_end, bpu1102I_fragment[4:], bpu1102I_sticky_end, ncoI_site-16, bpu1102I_site)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Projektowanie starterów
|
||||||
|
forward_primer = gfp_seq[:20] # Pierwsze 20 nukleotydów sekwencji GFP
|
||||||
|
reverse_primer = str(Seq(gfp_seq_with_his6[-20:]).reverse_complement()) # Ostatnie 20 nukleotydów + His6
|
||||||
|
|
||||||
|
print(f"Forward Primer: {forward_primer}")
|
||||||
|
print(f"Reverse Primer: {reverse_primer}")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Miejsca cięcia restryktazy
|
||||||
|
enzymes = RestrictionBatch([EcoRI, BamHI, HindIII])
|
||||||
|
#enzymes = RestrictionBatch([BamHI, ])
|
||||||
|
restriction_sites = enzymes.search(record.seq)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Przeprowadzenie analizy restrykcyjnej
|
||||||
|
analysis = Analysis(AllEnzymes, record.seq)
|
||||||
|
|
||||||
|
# Wynik analizy
|
||||||
|
results = analysis.full()
|
||||||
|
|
||||||
|
# Wyświetlanie wyników
|
||||||
|
#for enzyme in results:
|
||||||
|
# if len(results[enzyme]) > 0:
|
||||||
|
# print(f"{enzyme}: {results[enzyme]}")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Utwórz diagram plazmidu
|
||||||
|
diagram = GenomeDiagram.Diagram("PUC19 Plasmid Map")
|
||||||
|
track = diagram.new_track(1, name="Annotated Features", greytrack=True)
|
||||||
|
feature_set = track.new_set()
|
||||||
|
|
||||||
|
# Dodanie sekwencji kodującej GFP
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(0, len(gfp_seq)), strand=+1),
|
||||||
|
name="GFP Coding Sequence",
|
||||||
|
label=True,
|
||||||
|
color=colors.lightblue
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie His6 tagu
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(len(gfp_seq), len(gfp_seq_with_his6)), strand=+1),
|
||||||
|
name="His6 Tag",
|
||||||
|
label=True,
|
||||||
|
color=colors.lightgreen
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie forward primer
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(0, len(forward_primer)), strand=+1),
|
||||||
|
name="Forward Primer",
|
||||||
|
label=True,
|
||||||
|
color=colors.orange
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie reverse primer
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(len(gfp_seq_with_his6) - len(reverse_primer), len(gfp_seq_with_his6)), strand=-1),
|
||||||
|
name="Reverse Primer",
|
||||||
|
label=True,
|
||||||
|
color=colors.red
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie miejsc cięcia restryktazy
|
||||||
|
for enzyme, sites in restriction_sites.items():
|
||||||
|
for site in sites:
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(site, site + 1), strand=0),
|
||||||
|
name=enzyme,
|
||||||
|
label=True,
|
||||||
|
color=colors.purple
|
||||||
|
)
|
||||||
|
|
||||||
|
# Rysowanie diagramu
|
||||||
|
diagram.draw(format="circular", circular=True, pagesize='A4', start=0, end=len(record), circle_core=0.5)
|
||||||
|
diagram.write("pdf/plasmid_map.pdf", "PDF")
|
||||||
|
|
||||||
|
print("Zapisano diagram plazmidu do pliku 'plasmid_map.pdf'")
|
||||||
Loading…
Reference in New Issue