67 lines
3.5 KiB
Plaintext
67 lines
3.5 KiB
Plaintext
LOCUS SCU87974 818 bp mRNA linear SYN 24-FEB-1997
|
|
DEFINITION Synthetic construct modified green fluorescent protein GFP5-ER
|
|
(mgfp5-ER) mRNA, complete cds.
|
|
ACCESSION U87974
|
|
VERSION U87974.1
|
|
KEYWORDS .
|
|
SOURCE synthetic construct
|
|
ORGANISM synthetic construct
|
|
other sequences; artificial sequences.
|
|
REFERENCE 1 (bases 1 to 818)
|
|
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
|
|
TITLE Mutations that suppress the thermosensitivity of green fluorescent
|
|
protein
|
|
JOURNAL Curr. Biol. 6 (12), 1653-1663 (1996)
|
|
PUBMED 8994830
|
|
REFERENCE 2 (bases 1 to 818)
|
|
AUTHORS Haseloff,J., Siemering,K.R., Prasher,D. and Hodge,S.
|
|
TITLE Removal of a cryptic intron and subcellular localisation of green
|
|
fluorescent protein are required to mark transgenic Arabidopsis
|
|
plants brightly
|
|
JOURNAL Proc. Natl. Acad. Sci. U.S.A. (1997) In press
|
|
REFERENCE 3 (bases 1 to 818)
|
|
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
|
|
TITLE Direct Submission
|
|
JOURNAL Submitted (31-JAN-1997) Division of Cell Biology, MRC Laboratory of
|
|
Molecular Biology, Hills Road, Cambridge CB2 2QH, UK
|
|
FEATURES Location/Qualifiers
|
|
source 1..818
|
|
/organism="synthetic construct"
|
|
/mol_type="mRNA"
|
|
/db_xref="taxon:32630"
|
|
gene 1..818
|
|
/gene="mgfp5-ER"
|
|
CDS 21..812
|
|
/gene="mgfp5-ER"
|
|
/note="contains codon usage changes that disrupt a cryptic
|
|
plant intron, mutations that increase the thermotolerance
|
|
and change the spectral characteristics of the protein, and
|
|
sequences that code for signal peptides that result in
|
|
retention of the protein in the plant endoplasmic
|
|
reticulum"
|
|
/codon_start=1
|
|
/transl_table=11
|
|
/product="modified green fluorescent protein GFP5-ER"
|
|
/protein_id="AAB47999.1"
|
|
/translation="MKTNLFLFLIFSLLLSLSSAEFSKGEELFTGVVPILVELDGDVNG
|
|
HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDF
|
|
FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
|
|
YNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYL
|
|
STQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKHDEL"
|
|
ORIGIN
|
|
1 ggatccaagg agatataaca atgaagacta atctttttct ctttctcatc ttttcacttc
|
|
61 tcctatcatt atcctcggcc gaattcagta aaggagaaga acttttcact ggagttgtcc
|
|
121 caattcttgt tgaattagat ggtgatgtta atgggcacaa attttctgtc agtggagagg
|
|
181 gtgaaggtga tgcaacatac ggaaaactta cccttaaatt tatttgcact actggaaaac
|
|
241 tacctgttcc atggccaaca cttgtcacta ctttctctta tggtgttcaa tgcttttcaa
|
|
301 gatacccaga tcatatgaag cggcacgact tcttcaagag cgccatgcct gagggatacg
|
|
361 tgcaggagag gaccatcttc ttcaaggacg acgggaacta caagacacgt gctgaagtca
|
|
421 agtttgaggg agacaccctc gtcaacagga tcgagcttaa gggaatcgat ttcaaggagg
|
|
481 acggaaacat cctcggccac aagttggaat acaactacaa ctcccacaac gtatacatca
|
|
541 tggccgacaa gcaaaagaac ggcatcaaag ccaacttcaa gacccgccac aacatcgaag
|
|
601 acggcggcgt gcaactcgct gatcattatc aacaaaatac tccaattggc gatggccctg
|
|
661 tccttttacc agacaaccat tacctgtcca cacaatctgc cctttcgaaa gatcccaacg
|
|
721 aaaagagaga ccacatggtc cttcttgagt ttgtaacagc tgctgggatt acacatggca
|
|
781 tggatgaact atacaaacat gatgagcttt aagagctc
|
|
//
|