LOCUS       SCU87974                 818 bp    mRNA    linear   SYN 24-FEB-1997
DEFINITION  Synthetic construct modified green fluorescent protein GFP5-ER
            (mgfp5-ER) mRNA, complete cds.
ACCESSION   U87974
VERSION     U87974.1
KEYWORDS    .
SOURCE      synthetic construct
  ORGANISM  synthetic construct
            other sequences; artificial sequences.
REFERENCE   1  (bases 1 to 818)
  AUTHORS   Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
  TITLE     Mutations that suppress the thermosensitivity of green fluorescent
            protein
  JOURNAL   Curr. Biol. 6 (12), 1653-1663 (1996)
   PUBMED   8994830
REFERENCE   2  (bases 1 to 818)
  AUTHORS   Haseloff,J., Siemering,K.R., Prasher,D. and Hodge,S.
  TITLE     Removal of a cryptic intron and subcellular localisation of green
            fluorescent protein are required to mark transgenic Arabidopsis
            plants brightly
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. (1997) In press
REFERENCE   3  (bases 1 to 818)
  AUTHORS   Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JAN-1997) Division of Cell Biology, MRC Laboratory of
            Molecular Biology, Hills Road, Cambridge CB2 2QH, UK
FEATURES             Location/Qualifiers
     source          1..818
                     /organism="synthetic construct"
                     /mol_type="mRNA"
                     /db_xref="taxon:32630"
     gene            1..818
                     /gene="mgfp5-ER"
     CDS             21..812
                     /gene="mgfp5-ER"
                     /note="contains codon usage changes that disrupt a cryptic
                     plant intron, mutations that increase the thermotolerance
                     and change the spectral characteristics of the protein, and
                     sequences that code for signal peptides that result in
                     retention of the protein in the plant endoplasmic
                     reticulum"
                     /codon_start=1
                     /transl_table=11
                     /product="modified green fluorescent protein GFP5-ER"
                     /protein_id="AAB47999.1"
                     /translation="MKTNLFLFLIFSLLLSLSSAEFSKGEELFTGVVPILVELDGDVNG
                     HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDF
                     FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
                     YNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYL
                     STQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKHDEL"
ORIGIN
        1 ggatccaagg agatataaca atgaagacta atctttttct ctttctcatc ttttcacttc
       61 tcctatcatt atcctcggcc gaattcagta aaggagaaga acttttcact ggagttgtcc
      121 caattcttgt tgaattagat ggtgatgtta atgggcacaa attttctgtc agtggagagg
      181 gtgaaggtga tgcaacatac ggaaaactta cccttaaatt tatttgcact actggaaaac
      241 tacctgttcc atggccaaca cttgtcacta ctttctctta tggtgttcaa tgcttttcaa
      301 gatacccaga tcatatgaag cggcacgact tcttcaagag cgccatgcct gagggatacg
      361 tgcaggagag gaccatcttc ttcaaggacg acgggaacta caagacacgt gctgaagtca
      421 agtttgaggg agacaccctc gtcaacagga tcgagcttaa gggaatcgat ttcaaggagg
      481 acggaaacat cctcggccac aagttggaat acaactacaa ctcccacaac gtatacatca
      541 tggccgacaa gcaaaagaac ggcatcaaag ccaacttcaa gacccgccac aacatcgaag
      601 acggcggcgt gcaactcgct gatcattatc aacaaaatac tccaattggc gatggccctg
      661 tccttttacc agacaaccat tacctgtcca cacaatctgc cctttcgaaa gatcccaacg
      721 aaaagagaga ccacatggtc cttcttgagt ttgtaacagc tgctgggatt acacatggca
      781 tggatgaact atacaaacat gatgagcttt aagagctc
//