Dodano ciecia restryktazami
This commit is contained in:
mpabi
parent
5b8592fbd7
commit
d198b3723d
|
|
@ -0,0 +1,66 @@
|
||||||
|
LOCUS SCU87974 818 bp mRNA linear SYN 24-FEB-1997
|
||||||
|
DEFINITION Synthetic construct modified green fluorescent protein GFP5-ER
|
||||||
|
(mgfp5-ER) mRNA, complete cds.
|
||||||
|
ACCESSION U87974
|
||||||
|
VERSION U87974.1
|
||||||
|
KEYWORDS .
|
||||||
|
SOURCE synthetic construct
|
||||||
|
ORGANISM synthetic construct
|
||||||
|
other sequences; artificial sequences.
|
||||||
|
REFERENCE 1 (bases 1 to 818)
|
||||||
|
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
|
||||||
|
TITLE Mutations that suppress the thermosensitivity of green fluorescent
|
||||||
|
protein
|
||||||
|
JOURNAL Curr. Biol. 6 (12), 1653-1663 (1996)
|
||||||
|
PUBMED 8994830
|
||||||
|
REFERENCE 2 (bases 1 to 818)
|
||||||
|
AUTHORS Haseloff,J., Siemering,K.R., Prasher,D. and Hodge,S.
|
||||||
|
TITLE Removal of a cryptic intron and subcellular localisation of green
|
||||||
|
fluorescent protein are required to mark transgenic Arabidopsis
|
||||||
|
plants brightly
|
||||||
|
JOURNAL Proc. Natl. Acad. Sci. U.S.A. (1997) In press
|
||||||
|
REFERENCE 3 (bases 1 to 818)
|
||||||
|
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
|
||||||
|
TITLE Direct Submission
|
||||||
|
JOURNAL Submitted (31-JAN-1997) Division of Cell Biology, MRC Laboratory of
|
||||||
|
Molecular Biology, Hills Road, Cambridge CB2 2QH, UK
|
||||||
|
FEATURES Location/Qualifiers
|
||||||
|
source 1..818
|
||||||
|
/organism="synthetic construct"
|
||||||
|
/mol_type="mRNA"
|
||||||
|
/db_xref="taxon:32630"
|
||||||
|
gene 1..818
|
||||||
|
/gene="mgfp5-ER"
|
||||||
|
CDS 21..812
|
||||||
|
/gene="mgfp5-ER"
|
||||||
|
/note="contains codon usage changes that disrupt a cryptic
|
||||||
|
plant intron, mutations that increase the thermotolerance
|
||||||
|
and change the spectral characteristics of the protein, and
|
||||||
|
sequences that code for signal peptides that result in
|
||||||
|
retention of the protein in the plant endoplasmic
|
||||||
|
reticulum"
|
||||||
|
/codon_start=1
|
||||||
|
/transl_table=11
|
||||||
|
/product="modified green fluorescent protein GFP5-ER"
|
||||||
|
/protein_id="AAB47999.1"
|
||||||
|
/translation="MKTNLFLFLIFSLLLSLSSAEFSKGEELFTGVVPILVELDGDVNG
|
||||||
|
HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDF
|
||||||
|
FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
|
||||||
|
YNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYL
|
||||||
|
STQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKHDEL"
|
||||||
|
ORIGIN
|
||||||
|
1 ggatccaagg agatataaca atgaagacta atctttttct ctttctcatc ttttcacttc
|
||||||
|
61 tcctatcatt atcctcggcc gaattcagta aaggagaaga acttttcact ggagttgtcc
|
||||||
|
121 caattcttgt tgaattagat ggtgatgtta atgggcacaa attttctgtc agtggagagg
|
||||||
|
181 gtgaaggtga tgcaacatac ggaaaactta cccttaaatt tatttgcact actggaaaac
|
||||||
|
241 tacctgttcc atggccaaca cttgtcacta ctttctctta tggtgttcaa tgcttttcaa
|
||||||
|
301 gatacccaga tcatatgaag cggcacgact tcttcaagag cgccatgcct gagggatacg
|
||||||
|
361 tgcaggagag gaccatcttc ttcaaggacg acgggaacta caagacacgt gctgaagtca
|
||||||
|
421 agtttgaggg agacaccctc gtcaacagga tcgagcttaa gggaatcgat ttcaaggagg
|
||||||
|
481 acggaaacat cctcggccac aagttggaat acaactacaa ctcccacaac gtatacatca
|
||||||
|
541 tggccgacaa gcaaaagaac ggcatcaaag ccaacttcaa gacccgccac aacatcgaag
|
||||||
|
601 acggcggcgt gcaactcgct gatcattatc aacaaaatac tccaattggc gatggccctg
|
||||||
|
661 tccttttacc agacaaccat tacctgtcca cacaatctgc cctttcgaaa gatcccaacg
|
||||||
|
721 aaaagagaga ccacatggtc cttcttgagt ttgtaacagc tgctgggatt acacatggca
|
||||||
|
781 tggatgaact atacaaacat gatgagcttt aagagctc
|
||||||
|
//
|
||||||
|
|
@ -0,0 +1,258 @@
|
||||||
|
#! /usr/bin/env python3
|
||||||
|
# vim:fenc=utf-8
|
||||||
|
#
|
||||||
|
# Copyright © 2024 user <user@penguin>
|
||||||
|
#
|
||||||
|
# Distributed under terms of the MIT license.
|
||||||
|
import os
|
||||||
|
from Bio import Entrez, SeqIO
|
||||||
|
from Bio.Seq import Seq
|
||||||
|
from Bio.SeqFeature import SeqFeature, FeatureLocation
|
||||||
|
|
||||||
|
from Bio.Restriction import RestrictionBatch, EcoRI, BamHI, HindIII, Bpu1102I
|
||||||
|
from Bio.Restriction import AllEnzymes, Analysis
|
||||||
|
|
||||||
|
from Bio.Graphics import GenomeDiagram
|
||||||
|
from reportlab.lib import colors
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Ustawienia Entrez
|
||||||
|
Entrez.email = "your_email@example.com" # Wpisz swój adres email
|
||||||
|
|
||||||
|
# Funkcja do pobierania sekwencji z NCBI i zapisywania jej lokalnie
|
||||||
|
def fetch_and_save_sequence(db, id, file_path):
|
||||||
|
handle = Entrez.efetch(db=db, id=id, rettype="gb", retmode="text")
|
||||||
|
record = SeqIO.read(handle, "genbank")
|
||||||
|
handle.close()
|
||||||
|
SeqIO.write(record, file_path, "genbank")
|
||||||
|
return record
|
||||||
|
|
||||||
|
# Funkcja do wczytywania sekwencji z lokalnego pliku
|
||||||
|
def load_local_sequence(file_path):
|
||||||
|
with open(file_path, 'r') as file:
|
||||||
|
record = SeqIO.read(file, "genbank")
|
||||||
|
return record
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
# ID dla sekwencji w NCBI
|
||||||
|
gfp_id = "U87974"
|
||||||
|
plasmid_id = "pET-28a(+)"
|
||||||
|
|
||||||
|
# Ścieżki do lokalnych plików
|
||||||
|
gfp_file_path = gfp_id+'.gb'
|
||||||
|
plasmid_file_path = plasmid_id+'.gb'
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sprawdzanie i pobieranie sekwencji GFP
|
||||||
|
if not os.path.exists(gfp_file_path):
|
||||||
|
print(f"Plik {gfp_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||||
|
gfp_record = fetch_and_save_sequence("nuccore", gfp_id, gfp_file_path)
|
||||||
|
print(f"Pobrano i zapisano sekwencję GFP do pliku {gfp_file_path}.")
|
||||||
|
else:
|
||||||
|
print(f"Plik {gfp_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||||
|
gfp_record = load_local_sequence(gfp_file_path)
|
||||||
|
print(f"Wczytano dane z pliku {gfp_file_path}.")
|
||||||
|
|
||||||
|
gfp_seq = str(gfp_record.seq)
|
||||||
|
print(f"GFP Sequence: {gfp_seq[:60]}...")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sprawdzanie i pobieranie sekwencji plazmidu
|
||||||
|
if not os.path.exists(plasmid_file_path):
|
||||||
|
print(f"Plik {plasmid_file_path} nie istnieje. Pobieranie z serwera NCBI...")
|
||||||
|
record = fetch_and_save_sequence("nuccore", plasmid_id, plasmid_file_path)
|
||||||
|
print(f"Pobrano i zapisano sekwencję plazmidu do pliku {plasmid_file_path}.")
|
||||||
|
else:
|
||||||
|
print(f"Plik {plasmid_file_path} istnieje. Wczytywanie danych z lokalnego pliku...")
|
||||||
|
record = load_local_sequence(plasmid_file_path)
|
||||||
|
print(f"Wczytano dane z pliku {plasmid_file_path}.")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Wyświetl etykiety (annotacje)
|
||||||
|
for feature in record.features:
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
if 'gene' in feature.qualifiers:
|
||||||
|
print(f"Gene: {feature.qualifiers['gene']}")
|
||||||
|
if 'product' in feature.qualifiers:
|
||||||
|
print(f"Product: {feature.qualifiers['product']}")
|
||||||
|
print()
|
||||||
|
#%%
|
||||||
|
|
||||||
|
|
||||||
|
# Znajdź i wyświetl sekwencję terminatora T7
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||||
|
print("Terminator T7 znaleziony:")
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
print(f"Sequence: {record.seq[feature.location.start:feature.location.end]}")
|
||||||
|
print()
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Znajdź i wyświetl sekwencję terminatora T7
|
||||||
|
for feature in record.features:
|
||||||
|
if feature.type == "terminator" and "T7" in feature.qualifiers.get('note', [''])[0]:
|
||||||
|
print("Terminator T7 znaleziony:")
|
||||||
|
print(f"Type: {feature.type}")
|
||||||
|
print(f"Location: {feature.location}")
|
||||||
|
|
||||||
|
# Pobierz sekwencję terminatora
|
||||||
|
terminator_seq = record.seq[feature.location.start:feature.location.end]
|
||||||
|
|
||||||
|
# Sprawdź orientację i odwróć/uzupełnij jeśli potrzebne
|
||||||
|
if feature.strand == -1:
|
||||||
|
terminator_seq = terminator_seq.reverse_complement()
|
||||||
|
|
||||||
|
print(f"Sequence: {terminator_seq}")
|
||||||
|
print()
|
||||||
|
|
||||||
|
|
||||||
|
#%%
|
||||||
|
|
||||||
|
# Sekwencja DNA
|
||||||
|
dna_seq = record.seq
|
||||||
|
|
||||||
|
# Znajdź miejsca cięcia dla NcoI i Bpu1102I
|
||||||
|
ncoI_sites = NcoI.search(dna_seq)
|
||||||
|
bpu1102I_sites = Bpu1102I.search(dna_seq)
|
||||||
|
|
||||||
|
# Przyjmij pierwsze miejsca cięcia
|
||||||
|
ncoI_site = ncoI_sites[0]
|
||||||
|
bpu1102I_site = bpu1102I_sites[0]
|
||||||
|
|
||||||
|
# Wyodrębnij fragmenty 20 zasad od miejsc cięcia
|
||||||
|
ncoI_fragment = dna_seq[ncoI_site-16:ncoI_site+4] # 16 zasad przed i 4 po cięciu
|
||||||
|
bpu1102I_fragment = dna_seq[bpu1102I_site:bpu1102I_site+20] # 20 zasad po cięciu
|
||||||
|
|
||||||
|
# Lepkie końce
|
||||||
|
ncoI_sticky_end = ncoI_fragment[-4:]
|
||||||
|
ncoI_sticky_end_comp = ncoI_sticky_end.complement()
|
||||||
|
|
||||||
|
bpu1102I_sticky_end = bpu1102I_fragment[:4]
|
||||||
|
bpu1102I_sticky_end_comp = bpu1102I_sticky_end.complement()
|
||||||
|
|
||||||
|
# Funkcja do wyświetlania dwuniciowego DNA z lepkimi końcami w formacie schodkowym z indeksami dla dłuższej nici
|
||||||
|
def print_sticky_ends(seq1, sticky_end1, seq2, sticky_end2, start1, start2):
|
||||||
|
# Convert sequences to strings
|
||||||
|
seq1_str = str(seq1)
|
||||||
|
sticky_end1_str = str(sticky_end1)
|
||||||
|
comp_seq1_str = str(seq1.complement())
|
||||||
|
sticky_end1_comp_str = str(sticky_end1.complement())
|
||||||
|
|
||||||
|
seq2_str = str(seq2)
|
||||||
|
sticky_end2_str = str(sticky_end2)
|
||||||
|
comp_seq2_str = str(seq2.complement())
|
||||||
|
sticky_end2_comp_str = str(sticky_end2.complement())
|
||||||
|
|
||||||
|
# Add indexes to the ends
|
||||||
|
seq1_with_index = f"{seq1_str[:-1]} -{start1+len(seq1_str)-1}"
|
||||||
|
comp_seq1_with_index = f"{comp_seq1_str[:-1]}"
|
||||||
|
|
||||||
|
seq2_with_index = f"{start2}- {seq2_str[1:]}"
|
||||||
|
comp_seq2_with_index = f"{comp_seq2_str[1:]}"
|
||||||
|
|
||||||
|
# Lustrzane odbicie sekwencji
|
||||||
|
comp_seq2_with_index = comp_seq2_with_index[::-1]
|
||||||
|
sticky_end2_comp_str = sticky_end2_comp_str[::-1]
|
||||||
|
|
||||||
|
# Format the output as requested
|
||||||
|
print(f"5'-{seq1_with_index} {sticky_end1_str}-3' (+)")
|
||||||
|
print(f"3'-{comp_seq1_with_index}{sticky_end1_comp_str}-5'")
|
||||||
|
print()
|
||||||
|
print(f"5'-{sticky_end2_str} {seq2_with_index}-3' (+)")
|
||||||
|
print(f" {sticky_end2_comp_str}{comp_seq2_with_index}-5'")
|
||||||
|
|
||||||
|
# Wyświetl lepkie końce fragmentów
|
||||||
|
print("Fragmenty po cięciu NcoI i Bpu1102I:")
|
||||||
|
print_sticky_ends(ncoI_fragment[:-4], ncoI_sticky_end, bpu1102I_fragment[4:], bpu1102I_sticky_end, ncoI_site-16, bpu1102I_site)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Dodanie sekwencji kodującej His6
|
||||||
|
his6_tag = "CACCACCACCACCACCAC" # Sekwencja kodująca 6x histydynę (His6)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Sekwencja białka GFP z His6 tagiem na końcu
|
||||||
|
t = gfp_seq_with_his6 = gfp_seq + his6_tag
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Projektowanie starterów
|
||||||
|
forward_primer = gfp_seq[:20] # Pierwsze 20 nukleotydów sekwencji GFP
|
||||||
|
reverse_primer = str(Seq(gfp_seq_with_his6[-20:]).reverse_complement()) # Ostatnie 20 nukleotydów + His6
|
||||||
|
|
||||||
|
print(f"Forward Primer: {forward_primer}")
|
||||||
|
print(f"Reverse Primer: {reverse_primer}")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Miejsca cięcia restryktazy
|
||||||
|
enzymes = RestrictionBatch([EcoRI, BamHI, HindIII])
|
||||||
|
#enzymes = RestrictionBatch([BamHI, ])
|
||||||
|
restriction_sites = enzymes.search(record.seq)
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Przeprowadzenie analizy restrykcyjnej
|
||||||
|
analysis = Analysis(AllEnzymes, record.seq)
|
||||||
|
|
||||||
|
# Wynik analizy
|
||||||
|
results = analysis.full()
|
||||||
|
|
||||||
|
# Wyświetlanie wyników
|
||||||
|
#for enzyme in results:
|
||||||
|
# if len(results[enzyme]) > 0:
|
||||||
|
# print(f"{enzyme}: {results[enzyme]}")
|
||||||
|
|
||||||
|
#%%
|
||||||
|
# Utwórz diagram plazmidu
|
||||||
|
diagram = GenomeDiagram.Diagram("PUC19 Plasmid Map")
|
||||||
|
track = diagram.new_track(1, name="Annotated Features", greytrack=True)
|
||||||
|
feature_set = track.new_set()
|
||||||
|
|
||||||
|
# Dodanie sekwencji kodującej GFP
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(0, len(gfp_seq)), strand=+1),
|
||||||
|
name="GFP Coding Sequence",
|
||||||
|
label=True,
|
||||||
|
color=colors.lightblue
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie His6 tagu
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(len(gfp_seq), len(gfp_seq_with_his6)), strand=+1),
|
||||||
|
name="His6 Tag",
|
||||||
|
label=True,
|
||||||
|
color=colors.lightgreen
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie forward primer
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(0, len(forward_primer)), strand=+1),
|
||||||
|
name="Forward Primer",
|
||||||
|
label=True,
|
||||||
|
color=colors.orange
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie reverse primer
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(len(gfp_seq_with_his6) - len(reverse_primer), len(gfp_seq_with_his6)), strand=-1),
|
||||||
|
name="Reverse Primer",
|
||||||
|
label=True,
|
||||||
|
color=colors.red
|
||||||
|
)
|
||||||
|
|
||||||
|
# Dodanie miejsc cięcia restryktazy
|
||||||
|
for enzyme, sites in restriction_sites.items():
|
||||||
|
for site in sites:
|
||||||
|
feature_set.add_feature(
|
||||||
|
SeqFeature(FeatureLocation(site, site + 1), strand=0),
|
||||||
|
name=enzyme,
|
||||||
|
label=True,
|
||||||
|
color=colors.purple
|
||||||
|
)
|
||||||
|
|
||||||
|
# Rysowanie diagramu
|
||||||
|
diagram.draw(format="circular", circular=True, pagesize='A4', start=0, end=len(record), circle_core=0.5)
|
||||||
|
diagram.write("pdf/plasmid_map.pdf", "PDF")
|
||||||
|
|
||||||
|
print("Zapisano diagram plazmidu do pliku 'plasmid_map.pdf'")
|
||||||
|
|
@ -0,0 +1,193 @@
|
||||||
|
LOCUS 40924_17796 5369 bp DNA circular SYN 14-OCT-2021
|
||||||
|
DEFINITION synthetic circular DNA.
|
||||||
|
ACCESSION .
|
||||||
|
VERSION .
|
||||||
|
KEYWORDS .
|
||||||
|
SOURCE synthetic DNA construct
|
||||||
|
ORGANISM synthetic DNA construct
|
||||||
|
REFERENCE 1 (bases 1 to 5369)
|
||||||
|
AUTHORS caoheibi
|
||||||
|
TITLE Direct Submission
|
||||||
|
REFERENCE 2 (bases 1 to 5369)
|
||||||
|
AUTHORS .
|
||||||
|
TITLE Direct Submission
|
||||||
|
COMMENT SGRef: number: 1; type: "Journal Article"
|
||||||
|
FEATURES Location/Qualifiers
|
||||||
|
source 1..5369
|
||||||
|
/mol_type="other DNA"
|
||||||
|
/organism="synthetic DNA construct"
|
||||||
|
terminator complement(26..73)
|
||||||
|
/label=T7 terminator
|
||||||
|
/note="transcription terminator for bacteriophage T7 RNA
|
||||||
|
polymerase"
|
||||||
|
CDS complement(140..157)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
CDS complement(207..239)
|
||||||
|
/codon_start=1
|
||||||
|
/label=T7 tag (gene 10 leader)
|
||||||
|
/note="leader peptide from bacteriophage T7 gene 10"
|
||||||
|
/translation="MASMTGGQQMG"
|
||||||
|
CDS complement(243..260)
|
||||||
|
/codon_start=1
|
||||||
|
/label=thrombin site
|
||||||
|
/note="thrombin recognition and cleavage site"
|
||||||
|
/translation="LVPRGS"
|
||||||
|
CDS complement(270..287)
|
||||||
|
/codon_start=1
|
||||||
|
/label=6xHis
|
||||||
|
/note="6xHis affinity tag"
|
||||||
|
/translation="HHHHHH"
|
||||||
|
RBS complement(306..328)
|
||||||
|
/label=RBS
|
||||||
|
/note="efficient ribosome binding site from bacteriophage
|
||||||
|
T7 gene 10 (Olins and Rangwala, 1989)"
|
||||||
|
protein_bind complement(343..367)
|
||||||
|
/label=lac operator
|
||||||
|
/note="The lac repressor binds to the lac operator to
|
||||||
|
inhibit transcription in E. coli. This inhibition can be
|
||||||
|
relieved by adding lactose or
|
||||||
|
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
|
||||||
|
promoter complement(368..386)
|
||||||
|
/label=T7 promoter
|
||||||
|
/note="promoter for bacteriophage T7 RNA polymerase"
|
||||||
|
promoter 695..772
|
||||||
|
/label=lacI promoter
|
||||||
|
CDS 773..1852
|
||||||
|
/codon_start=1
|
||||||
|
/label=lacI
|
||||||
|
/note="lac repressor"
|
||||||
|
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
|
||||||
|
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
|
||||||
|
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
|
||||||
|
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
|
||||||
|
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
|
||||||
|
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
|
||||||
|
ALADSLMQLARQVSRLESGQ"
|
||||||
|
protein_bind 1868..1889
|
||||||
|
/label=CAP binding site
|
||||||
|
/note="CAP binding activates transcription in the presence
|
||||||
|
of cAMP."
|
||||||
|
CDS 2664..2852
|
||||||
|
/codon_start=1
|
||||||
|
/label=rop
|
||||||
|
/note="Rop protein, which maintains plasmids at low copy
|
||||||
|
number"
|
||||||
|
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
|
||||||
|
DELYRSCLARFGDDGENL"
|
||||||
|
misc_feature 2957..3099
|
||||||
|
/label=bom
|
||||||
|
/note="basis of mobility region from pBR322"
|
||||||
|
rep_origin complement(3285..3873)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=ori
|
||||||
|
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
|
||||||
|
replication"
|
||||||
|
CDS 3995..4807
|
||||||
|
/codon_start=1
|
||||||
|
/label=KanR
|
||||||
|
/note="aminoglycoside phosphotransferase"
|
||||||
|
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
|
||||||
|
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
|
||||||
|
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
|
||||||
|
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
|
||||||
|
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
|
||||||
|
rep_origin complement(4903..5358)
|
||||||
|
/direction=LEFT
|
||||||
|
/label=f1 ori
|
||||||
|
/note="f1 bacteriophage origin of replication; arrow
|
||||||
|
indicates direction of (+) strand synthesis"
|
||||||
|
ORIGIN
|
||||||
|
1 atccggatat agttcctcct ttcagcaaaa aacccctcaa gacccgttta gaggccccaa
|
||||||
|
61 ggggttatgc tagttattgc tcagcggtgg cagcagccaa ctcagcttcc tttcgggctt
|
||||||
|
121 tgttagcagc cggatctcag tggtggtggt ggtggtgctc gagtgcggcc gcaagcttgt
|
||||||
|
181 cgacggagct cgaattcgga tccgcgaccc atttgctgtc caccagtcat gctagccata
|
||||||
|
241 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg
|
||||||
|
301 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca
|
||||||
|
361 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc
|
||||||
|
421 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc
|
||||||
|
481 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc
|
||||||
|
541 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca
|
||||||
|
601 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg
|
||||||
|
661 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt
|
||||||
|
721 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc
|
||||||
|
781 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt
|
||||||
|
841 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc
|
||||||
|
901 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct
|
||||||
|
961 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat
|
||||||
|
1021 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg
|
||||||
|
1081 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat
|
||||||
|
1141 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt
|
||||||
|
1201 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca
|
||||||
|
1261 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc
|
||||||
|
1321 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa
|
||||||
|
1381 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat
|
||||||
|
1441 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct
|
||||||
|
1501 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg
|
||||||
|
1561 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat
|
||||||
|
1621 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg
|
||||||
|
1681 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact
|
||||||
|
1741 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc
|
||||||
|
1801 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca
|
||||||
|
1861 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga
|
||||||
|
1921 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac
|
||||||
|
1981 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca
|
||||||
|
2041 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat
|
||||||
|
2101 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg
|
||||||
|
2161 gcgagaagca ggccattatc gccggcatgg cggccccacg ggtgcgcatg atcgtgctcc
|
||||||
|
2221 tgtcgttgag gacccggcta ggctggcggg gttgccttac tggttagcag aatgaatcac
|
||||||
|
2281 cgatacgcga gcgaacgtga agcgactgct gctgcaaaac gtctgcgacc tgagcaacaa
|
||||||
|
2341 catgaatggt cttcggtttc cgtgtttcgt aaagtctgga aacgcggaag tcagcgccct
|
||||||
|
2401 gcaccattat gttccggatc tgcatcgcag gatgctgctg gctaccctgt ggaacaccta
|
||||||
|
2461 catctgtatt aacgaagcgc tggcattgac cctgagtgat ttttctctgg tcccgccgca
|
||||||
|
2521 tccataccgc cagttgttta ccctcacaac gttccagtaa ccgggcatgt tcatcatcag
|
||||||
|
2581 taacccgtat cgtgagcatc ctctctcgtt tcatcggtat cattaccccc atgaacagaa
|
||||||
|
2641 atccccctta cacggaggca tcagtgacca aacaggaaaa aaccgccctt aacatggccc
|
||||||
|
2701 gctttatcag aagccagaca ttaacgcttc tggagaaact caacgagctg gacgcggatg
|
||||||
|
2761 aacaggcaga catctgtgaa tcgcttcacg accacgctga tgagctttac cgcagctgcc
|
||||||
|
2821 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
|
||||||
|
2881 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
|
||||||
|
2941 ttggcgggtg tcggggcgca gccatgaccc agtcacgtag cgatagcgga gtgtatactg
|
||||||
|
3001 gcttaactat gcggcatcag agcagattgt actgagagtg caccatatat gcggtgtgaa
|
||||||
|
3061 ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc
|
||||||
|
3121 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg
|
||||||
|
3181 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc
|
||||||
|
3241 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc
|
||||||
|
3301 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga
|
||||||
|
3361 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc
|
||||||
|
3421 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat
|
||||||
|
3481 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg
|
||||||
|
3541 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc
|
||||||
|
3601 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga
|
||||||
|
3661 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact
|
||||||
|
3721 agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt
|
||||||
|
3781 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag
|
||||||
|
3841 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg
|
||||||
|
3901 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgaa caataaaact
|
||||||
|
3961 gtctgcttac ataaacagta atacaagggg tgttatgagc catattcaac gggaaacgtc
|
||||||
|
4021 ttgctctagg ccgcgattaa attccaacat ggatgctgat ttatatgggt ataaatgggc
|
||||||
|
4081 tcgcgataat gtcgggcaat caggtgcgac aatctatcga ttgtatggga agcccgatgc
|
||||||
|
4141 gccagagttg tttctgaaac atggcaaagg tagcgttgcc aatgatgtta cagatgagat
|
||||||
|
4201 ggtcagacta aactggctga cggaatttat gcctcttccg accatcaagc attttatccg
|
||||||
|
4261 tactcctgat gatgcatggt tactcaccac tgcgatcccc gggaaaacag cattccaggt
|
||||||
|
4321 attagaagaa tatcctgatt caggtgaaaa tattgttgat gcgctggcag tgttcctgcg
|
||||||
|
4381 ccggttgcat tcgattcctg tttgtaattg tccttttaac agcgatcgcg tatttcgtct
|
||||||
|
4441 cgctcaggcg caatcacgaa tgaataacgg tttggttgat gcgagtgatt ttgatgacga
|
||||||
|
4501 gcgtaatggc tggcctgttg aacaagtctg gaaagaaatg cataaacttt tgccattctc
|
||||||
|
4561 accggattca gtcgtcactc atggtgattt ctcacttgat aaccttattt ttgacgaggg
|
||||||
|
4621 gaaattaata ggttgtattg atgttggacg agtcggaatc gcagaccgat accaggatct
|
||||||
|
4681 tgccatccta tggaactgcc tcggtgagtt ttctccttca ttacagaaac ggctttttca
|
||||||
|
4741 aaaatatggt attgataatc ctgatatgaa taaattgcag tttcatttga tgctcgatga
|
||||||
|
4801 gtttttctaa gaattaattc atgagcggat acatatttga atgtatttag aaaaataaac
|
||||||
|
4861 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgaaattgta aacgttaata
|
||||||
|
4921 ttttgttaaa attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg
|
||||||
|
4981 aaatcggcaa aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc
|
||||||
|
5041 cagtttggaa caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa
|
||||||
|
5101 ccgtctatca gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt
|
||||||
|
5161 cgaggtgccg taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac
|
||||||
|
5221 ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta
|
||||||
|
5281 gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg
|
||||||
|
5341 cgccgctaca gggcgcgtcc cattcgcca
|
||||||
|
//
|
||||||
Loading…
Reference in New Issue