bio/U87974.gb

67 lines
3.5 KiB
Plaintext
Raw Permalink Normal View History

2024-06-11 20:32:15 +00:00
LOCUS SCU87974 818 bp mRNA linear SYN 24-FEB-1997
DEFINITION Synthetic construct modified green fluorescent protein GFP5-ER
(mgfp5-ER) mRNA, complete cds.
ACCESSION U87974
VERSION U87974.1
KEYWORDS .
SOURCE synthetic construct
ORGANISM synthetic construct
other sequences; artificial sequences.
REFERENCE 1 (bases 1 to 818)
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
TITLE Mutations that suppress the thermosensitivity of green fluorescent
protein
JOURNAL Curr. Biol. 6 (12), 1653-1663 (1996)
PUBMED 8994830
REFERENCE 2 (bases 1 to 818)
AUTHORS Haseloff,J., Siemering,K.R., Prasher,D. and Hodge,S.
TITLE Removal of a cryptic intron and subcellular localisation of green
fluorescent protein are required to mark transgenic Arabidopsis
plants brightly
JOURNAL Proc. Natl. Acad. Sci. U.S.A. (1997) In press
REFERENCE 3 (bases 1 to 818)
AUTHORS Siemering,K.R., Golbik,R., Sever,R. and Haseloff,J.
TITLE Direct Submission
JOURNAL Submitted (31-JAN-1997) Division of Cell Biology, MRC Laboratory of
Molecular Biology, Hills Road, Cambridge CB2 2QH, UK
FEATURES Location/Qualifiers
source 1..818
/organism="synthetic construct"
/mol_type="mRNA"
/db_xref="taxon:32630"
gene 1..818
/gene="mgfp5-ER"
CDS 21..812
/gene="mgfp5-ER"
/note="contains codon usage changes that disrupt a cryptic
plant intron, mutations that increase the thermotolerance
and change the spectral characteristics of the protein, and
sequences that code for signal peptides that result in
retention of the protein in the plant endoplasmic
reticulum"
/codon_start=1
/transl_table=11
/product="modified green fluorescent protein GFP5-ER"
/protein_id="AAB47999.1"
/translation="MKTNLFLFLIFSLLLSLSSAEFSKGEELFTGVVPILVELDGDVNG
HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDF
FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
YNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYL
STQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKHDEL"
ORIGIN
1 ggatccaagg agatataaca atgaagacta atctttttct ctttctcatc ttttcacttc
61 tcctatcatt atcctcggcc gaattcagta aaggagaaga acttttcact ggagttgtcc
121 caattcttgt tgaattagat ggtgatgtta atgggcacaa attttctgtc agtggagagg
181 gtgaaggtga tgcaacatac ggaaaactta cccttaaatt tatttgcact actggaaaac
241 tacctgttcc atggccaaca cttgtcacta ctttctctta tggtgttcaa tgcttttcaa
301 gatacccaga tcatatgaag cggcacgact tcttcaagag cgccatgcct gagggatacg
361 tgcaggagag gaccatcttc ttcaaggacg acgggaacta caagacacgt gctgaagtca
421 agtttgaggg agacaccctc gtcaacagga tcgagcttaa gggaatcgat ttcaaggagg
481 acggaaacat cctcggccac aagttggaat acaactacaa ctcccacaac gtatacatca
541 tggccgacaa gcaaaagaac ggcatcaaag ccaacttcaa gacccgccac aacatcgaag
601 acggcggcgt gcaactcgct gatcattatc aacaaaatac tccaattggc gatggccctg
661 tccttttacc agacaaccat tacctgtcca cacaatctgc cctttcgaaa gatcccaacg
721 aaaagagaga ccacatggtc cttcttgagt ttgtaacagc tgctgggatt acacatggca
781 tggatgaact atacaaacat gatgagcttt aagagctc
//